SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_1AL_95C7D27A7.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Traes_1AL_95C7D27A7.1
Domain Number - Region: 24-138
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0131
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_1AL_95C7D27A7.1
Sequence length 203
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_1AL_scaff_3897815:2:2617:-1 gene:Traes_1AL_95C7D27A7 transcript:Traes_1AL_95C7D27A7.1 description:""
Sequence
MAVKMASDGLWQGENPLDFTLPLLAVQIAVVLVVTQGLAFALKPLRQPRVIAEILGGILL
GPSALGRWGAFRRTIFPEWSTPALDTVSGLGLLLFLFLVGLELDFRAVRRVGPRSVAIAA
AGIVPPLLAAAGIVPLLXPGAPPSLIPLDVRVPRRRALGDRSPRARVHPQGARPPRSALR
RDRHGCRRRERRLRVGAPRARSR
Download sequence
Identical sequences Traes_1AL_95C7D27A7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]