SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_2DL_56AB4016E.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_2DL_56AB4016E.1
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-24
Family Inorganic pyrophosphatase 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_2DL_56AB4016E.1
Sequence length 87
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_2DL_scaff_9910443:140:990:1 gene:Traes_2DL_56AB4016E transcript:Traes_2DL_56AB4016E.1 description:""
Sequence
MPMIDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDYKKNENKEVAVDAF
LPATTAREAIQYSMDLYAQYILQSLRQ
Download sequence
Identical sequences Traes_2DL_56AB4016E.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]