SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_3AS_02FBA2155.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3AS_02FBA2155.2
Domain Number 1 Region: 112-228
Classification Level Classification E-value
Superfamily POZ domain 1.81e-25
Family BTB/POZ domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Traes_3AS_02FBA2155.2
Domain Number - Region: 31-69
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0347
Family MATH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_3AS_02FBA2155.2
Sequence length 250
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3AS_scaff_3441072:2665:3414:-1 gene:Traes_3AS_02FBA2155 transcript:Traes_3AS_02FBA2155.2 description:""
Sequence
MASLRMDDPFHRWPAAVWRSPGTNTFPASPATTSRSWKLSVPEAFFHGQEERYVVDDRLT
ILCVVHVLRLDVTLPNTRSCFISAVPPPTISGDLLMLLFASMSKSDSVKHAMRPDVTFIV
EQTEIRAHKLVLAVRSPVFAAEFRWHMNENIIIRVDDDDMSASTFRAMLRFIYTDELPIK
PNNDRMILTSEDKHAARRYEAMVRDLLVAADRYDLQRLRLLCEKVLAEGMDDKSVIPTLM
VVHGRYSCRQ
Download sequence
Identical sequences Traes_3AS_02FBA2155.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]