SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3B_23A4A62C0.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3B_23A4A62C0.1
Domain Number 1 Region: 60-177
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0000667
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.013
Further Details:      
 
Weak hits

Sequence:  Traes_3B_23A4A62C0.1
Domain Number - Region: 157-219
Classification Level Classification E-value
Superfamily Thymidylate synthase/dCMP hydroxymethylase 0.0872
Family Thymidylate synthase/dCMP hydroxymethylase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_3B_23A4A62C0.1
Sequence length 660
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3B_scaff_8205496:316:2661:1 gene:Traes_3B_23A4A62C0 transcript:Traes_3B_23A4A62C0.1 description:""
Sequence
MASTVAPLNADVDLPTNVTAQTHNATASKITNMVVCYSPMMITTNGIWQGVNPLEFSLPL
FILQVAVIVITTRVLVLLLKPFRQPRVIAEILAGVVLGPSLMGQMDGWGNLVFPQRSLLT
LETVAHLGLLYFLFLVGLEMDIDVIKRSGKKALFVALAGMALPFCIGTATSFILRHQVSR
NVHQTSFLLFLGVALSVTAFPVLARILAEIKLLNTELGRIAMSAAIVNDMCAWILLALAI
AITEVDSTALSSLWVLLSGVAFVLICFYVVRPAMWWLIHRIPEGESISDMDVSLILAGVL
LAGVCTEAIGIHSVFGAFIYGLVIPSGPLGVTLIEKLEDFVTGLLLPLFFAISGLRTNIT
KARDPVTVGLLVLVFVMASFAKIMGTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNI
GRDRQVLDDESFAVMVMVSVGMTALVTPIVTSLHKPARRLVGYKRRNLQRIRHDSELRML
ACVHTTRNVPSVLSLLDLSNPSKRSPIFIYALHLVELTGRASNMLAAAAASASTNSQSGS
SALPATTEHIFNAFENYEMHTGGVSIQTLAAVSPYQTMHEDVSVLAEDKHVSLIVVPFHK
QQTVDGGMEPINPSIRGFNESLLSTSPCSVAILVDRGLSAAAARMADEHRLVLFFFGGPD
Download sequence
Identical sequences Traes_3B_23A4A62C0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]