SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3B_CA312B98B.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3B_CA312B98B.1
Domain Number 1 Region: 695-835
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.49e-39
Family BRCA2 helical domain 0.00048
Further Details:      
 
Domain Number 2 Region: 836-978
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-34
Family Single strand DNA-binding domain, SSB 0.00034
Further Details:      
 
Domain Number 3 Region: 1009-1122
Classification Level Classification E-value
Superfamily BRCA2 tower domain 4.9e-30
Family BRCA2 tower domain 0.0021
Further Details:      
 
Domain Number 4 Region: 979-1008,1122-1207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-21
Family Single strand DNA-binding domain, SSB 0.0084
Further Details:      
 
Domain Number 5 Region: 1210-1368
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.22e-18
Family Single strand DNA-binding domain, SSB 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_3B_CA312B98B.1
Sequence length 1370
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3B_scaff_10618563:1721:11962:1 gene:Traes_3B_CA312B98B transcript:Traes_3B_CA312B98B.1 description:""
Sequence
MFRTGMGRPVPVSRTSIDKARAVLEGQTVAEKGVDGMEQFPLFQTGSGRVVSVSAASVQK
AKSVLKDNNTSEENTESFGRPNQPMMFQTGLGRPAMISERSIERSRAVANEGDAEKSGHW
DTDCQFPMFQTGLGKPVAVSWSSVQKAKSVLEEEKNKTTGRGESSDCATTLQTETPTSVL
MSSSLIMNSRSVTPKEDSAMQVTRTEKNHKDDDHVPLFQTGLGRSIAISKSSLKRASAVL
EPRNIAKELEDEAHLDGAHDTPVFRTGLGRSILASENSRKELPILEAEEAVKSVNNYNGE
TFVEEATFQAGIQKFVPQNRISSHKASMLLEQRNFMEKGYQDSGSQLPMFRTGSGKSVLI
SESSVQKARAVLEEQGINKDNHKLLNMDKKIPVFASPLKTSCARTVNISSVGVSRAATLL
GLEGNTLSTQFFGHVGDKLGTKINFEQENPEQRLGLASYPTENQVHKEPHRPFELSNNTV
SDSGEHSIRFSTAGGRSMAISSDALERAKSLLGESDLVVSTNNLVSYPLGSACNDKMQNS
TVAPKEGGSDLSKRRRVSGRTELATFSHQAMSDRKDTGSLGNAVSDIHPTSENTNRFHVG
SRSTSEIPKIVKPSSRCLSETDNTNDTKDKTRQLHMPAGALVDISNFMGSYSGNIDHVVN
EKRRIGGRNSASSFKRPRSSRFITPISTNRQSSAGVPKLPPTQITSCRTKLSAYYPFQHK
RKTWKEYFGGPPCFNCLAEHIIDEVKLMDAKGAEKYKFHNMNTGAEEFQKLLIACGASLT
YATKEWVNNHYKWIVWKLASLERCYPTKAAGKFLTVANVLDELKYRYDREVNNGHRSAIK
KILEGNALPSLMMVLCISAIYSHPDVNKLEAVGTDGNENSIENKSLLAAKRNMPAHIELT
DGWYALEASLDVALSEQLQKRKLFIGQKLRIWGASLCGWTGPVSFHEASGTVKLMVHVNG
SYRARWDDPLGFCKHVGPPLAFKCIKASGGRVPRTLVGVARIYPVLYKERLPDGSSIVRS
ERMERKALQLYHQRVSKIAEDIMSEQDENCASTDDSEEGAKICKMLEQAAEPEVMMAGLT
SEQMISFSSYQAKQKEARQNEVAKKVESALEVAGLSSRDVTPFLKVRVTSLAHKISATNT
IKKEGLITIWNPTEKQKADLVEGQVYIATGLLPSAHCTNILYLHARGSSTMWKPLASAQA
ADFQPFFTPRKAVELSLIGEVPLASEFDIAGVVLHVGDVYLCSNQKRQWLFLTDGSKFIS
ASQSTEQDDCLLAVSFSCSSASDDGAFFSYALSGNTVGFSNLVKRQKDQTRRIWVAEATQ
SSTYTLSHEISKKSHLKEAAACAEKWASSSFDKIQQLKERVLCIIGDSGG
Download sequence
Identical sequences Traes_3B_CA312B98B.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]