SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_5AS_4A7A9ED51.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Traes_5AS_4A7A9ED51.1
Domain Number - Region: 10-78
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0942
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5AS_4A7A9ED51.1
Sequence length 87
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5AS_scaff_1516149:1:1559:-1 gene:Traes_5AS_4A7A9ED51 transcript:Traes_5AS_4A7A9ED51.1 description:""
Sequence
ALPLIILQICLVIVVTRGLAYLLRPLRQPRVIAEIIGGILLGPSALGRSTTFLDAVFPAR
SMVVLDTLANLGLLFFLFLVGLELDLN
Download sequence
Identical sequences Traes_5AS_4A7A9ED51.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]