SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_5BS_E8AEC2C2B.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5BS_E8AEC2C2B.1
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-30
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_5BS_E8AEC2C2B.1
Sequence length 104
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5BS_scaff_2295038:28143:31260:-1 gene:Traes_5BS_E8AEC2C2B transcript:Traes_5BS_E8AEC2C2B.1 description:""
Sequence
MKPVVGIVVSNKMQKSVVVAVDRLFHNKVYNRYVKRTSKFMAHDEAEGCNIGDRVRLDPS
RPLSKNKHWIVAEVLRRAKMYVPPPPAPKASGATTQQSSSKSSV
Download sequence
Identical sequences W5FPC2
Traes_5BS_E8AEC2C2B.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]