SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_6BL_05BB1DD07.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_6BL_05BB1DD07.1
Domain Number 1 Region: 354-388
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000051
Family Rho termination factor, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_6BL_05BB1DD07.1
Sequence length 393
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_6BL_scaff_3291675:1493:3190:1 gene:Traes_6BL_05BB1DD07 transcript:Traes_6BL_05BB1DD07.1 description:""
Sequence
HQASSKAITDVYCLFFCPGVSSRGTLPVYHGNCRFVPGSCFLSKSTILGPLTVSLVCGAT
PNNHRPRNPDISRQQKRGSSSRGKSKPFQERDDSENNDEFDSDTVSSKNGPPISLTSNTR
PHATSAPGEREKEIVELFKRVQAQLRARGKGREDKKPEPAKSQGERGSVDSLLNLLRKHS
VDQKRKSGDEKEQNFDQTWRSSDSGNKQSSRIFGTKNDAQEGQKPPPATFQRPPSSFRRR
SPVPGVKFQLVTNPDADAKPVVNGMTDAVLKVKTPLEEETAQDEPDSVSPYEPDSVIAPE
DASLDDFVVSDDDSDVLDTDEPEDYLEPLDDADDVTDSIPSHVDSLEGSPSAEASDLSSL
KVTELRELAKSRGLRGYSKMKKSDLVALLSDVS
Download sequence
Identical sequences Traes_6BL_05BB1DD07.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]