SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7AS_80E40138D.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Traes_7AS_80E40138D.1
Domain Number - Region: 3-46
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0654
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_7AS_80E40138D.1
Sequence length 68
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7AS_scaff_1566607:8:236:-1 gene:Traes_7AS_80E40138D transcript:Traes_7AS_80E40138D.1 description:""
Sequence
MLVGMFGLMGAYAAGSSRNLKTSVYVLTLVGAVLAFIASLLAIFLLGPYLKSQEGRDFCF
VPFGKSQK
Download sequence
Identical sequences Traes_7AS_80E40138D.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]