SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_1DS_0ECA2B5BC.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_1DS_0ECA2B5BC.1
Domain Number 1 Region: 229-423
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-33
Family cAMP-binding domain 0.00000781
Further Details:      
 
Domain Number 2 Region: 28-83,163-263
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000122
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_1DS_0ECA2B5BC.1
Sequence length 522
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_1DS_scaff_1878642:3468:5218:-1 gene:Traes_1DS_0ECA2B5BC transcript:Traes_1DS_0ECA2B5BC.1 description:""
Sequence
MIKFFLRPKGADLLPIKTALFFIVLTQYLPRLVRFYPIISELKRTTGVFAETAFAGAAFY
LLLYMLASHMVGAFWYLLAVERVDDCWREKCAGLKFDRCVKFMYCGGAGATKDGENQFTE
FMEWRTMIRQVLKQECAPMDNNGTGFDYGIYSNAITSGVTHTQDLIPKILFCLWWGLQNL
STGAQGLETTHYKGEALFAILLALFGLILMALLIGNMQTYLQSMTLRMEEMRLKRRDTEQ
WMRHRHLPDDLMERVWRHNQYKWMETRGVDEDGLVSCLPKDIRRDVKRHLCLRLVLRVPL
FANMDERLLDAICERLKPSLCTESTYVVREGEPVDEMFFIIRGRLESSTTDGGRIGFFNK
ELLKEGDFCGEELLTWALDPKAAANLPLSTRSVKAISEVEGFALHADELKFVAGQFRRLH
SKQLQQTFRFYSQQWRTWASSFIQATWRRYQKRKRLEQRRREVEQMYGMASTSSSGHFKT
TFLVSRFAKKAMRNVLRKRLLREESLILLPKPPEPDFGRMHY
Download sequence
Identical sequences Traes_1DS_0ECA2B5BC.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]