SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_2BL_8C6E27685.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_2BL_8C6E27685.1
Domain Number 1 Region: 39-200
Classification Level Classification E-value
Superfamily SIS domain 2e-21
Family mono-SIS domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_2BL_8C6E27685.1
Sequence length 201
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_2BL_scaff_7983366:2974:4102:1 gene:Traes_2BL_8C6E27685 transcript:Traes_2BL_8C6E27685.1 description:""
Sequence
MSGRDAASPAPADASAICAQIAAVFAAPSAHPPARAVLVSELAAASSRGGRVFVHGVGRE
GLMMRALCMRLAHLGLPAHCVGDVTAPPALSGDLLVASAGPGAFSTVDAICGVARGAGAR
VVLLTARPEGDFPGRQADVVAHLPAQTMADDEDGAAAQAKLPMGSLYEGAMFVLFEMVVL
ELAGVLGQSPAQMRARHTNLE
Download sequence
Identical sequences W5BCF5
Traes_2BL_8C6E27685.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]