SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3AL_C97D62D50.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3AL_C97D62D50.1
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-18
Family B3 DNA binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 448-565
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 3 Region: 226-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000167
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_3AL_C97D62D50.1
Sequence length 567
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3AL_scaff_4452642:5892:9939:-1 gene:Traes_3AL_C97D62D50 transcript:Traes_3AL_C97D62D50.1 description:""
Sequence
MSDPCECCQIKLKFLRQINGNFMHSLVIPEWFVNQFGGKIWRTVKLESPNGNVYDVGVTE
NMNRTILKSGWASFVDANKIEENYSLMFRYLGNTRFKVTIFDSSGKQKASCCARMGTAAS
DVRNPSTFDVDNSSSSCGGTTQSSPSERSDSDGSQKESSYGYKKSAKKAAISDSSEELSA
EDSLSRDNLVESYDVQVHLNDYVLSGKCDLTVAQEAKIQALVEKIRSEIPVLVVQMKKTS
ANFGNLIIRKDYALKYFPCEATNIILQLPRKNKEWKCRFNPGRRNLYLGYFVHDNCVQEG
DICLFQPIAKVKEGRFTIIVHLLHKESVRRSPGGTAGMTHTATDRRTSAKTSLTARVKKT
SLTAHVKEEPATDGEHKTTDRRTGAKTTLTSRVKEEPATDGEDTSSLRPEEDGDNSEGAS
ETPFVLPERASITPAQEQKVREKVEAFESTVPVYVAILNKCNVARKSGMIITMGKQYALR
YLQKQYFTGHRGKKNVISLVLQREGKSRMWDTELRRGIDRMMICKGWVAFARGNHLQVGD
LCLFKLMESEEPLKMMVYIIRREKCLD
Download sequence
Identical sequences W5CGQ5
Traes_3AL_C97D62D50.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]