SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3AS_F565F74EF.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3AS_F565F74EF.2
Domain Number 1 Region: 841-976
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.53e-38
Family BRCA2 helical domain 0.00052
Further Details:      
 
Domain Number 2 Region: 977-1119
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.91e-34
Family Single strand DNA-binding domain, SSB 0.00037
Further Details:      
 
Domain Number 3 Region: 1150-1263
Classification Level Classification E-value
Superfamily BRCA2 tower domain 4.51e-30
Family BRCA2 tower domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1120-1149,1263-1348
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-21
Family Single strand DNA-binding domain, SSB 0.0084
Further Details:      
 
Domain Number 5 Region: 1351-1509
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-18
Family Single strand DNA-binding domain, SSB 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_3AS_F565F74EF.2
Sequence length 1511
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3AS_scaff_3349433:97:11819:1 gene:Traes_3AS_F565F74EF transcript:Traes_3AS_F565F74EF.2 description:""
Sequence
MADLLVQARNTLLEGDGMSGATVDAGEGQLFCTGSGRSVSVSERAIRRARALVGEEVEKA
GNKRKQPFDDVPGAEGESREMDAPFRGGVHNTTVPPVFQTGSGKAVLLGKDSIQKARAIL
GEQPFDHVPDAEGELSEMDAPFRGGVYNTTMPPVFQTGSGKAVLLGKDSIQKARVLLEGV
DGMEQFPLFQTGSGRVVSVTAASVQKAKSVLKDNNTREENTESFGRPNQXGSGRPAMISE
RSIERSRAVANEGDAEKSGHWDTDCQFPVFQTGLGKPVAVSWSSVQKAKAVLEEEKIKTT
GRGESSDCATTLQTETPTSVLMSSSLIMNSRSVTPKEDSAMQVTRTEKNHKDDDHVPLFQ
TGLGRSIAISKSSLKRASAVLEPRNIAKELEDEAHLDGAHDTPAFRTGLGRSILASENSR
KELPILEAEEAVKSVNNYNRETFVEEATFQAGIQKFVPQNRISSHKASMLLEQRNFMEKG
YKDSGSQLPLFRTGSGKSVLISESSVQKARAVLEEQGINKDNHKLLNMDKKIPVFASPLK
TSCARTVNISSVGVSRAATLLGLEENTLSTQFFGHVGDKLGTKINFEQENAEQRLGLASY
PTENQVHKEPHRPFELSNNTISDSGEHSIRFSTAGGRSMAISSDALERAKSLLGESDLVV
STNNLVSYPLGSACNDKMQNSTVVPKEGGSDLSKRRRVSGRTELATFSHQAMSDRKDTGS
FGNAVSDIHPTSENTNRFHVGSRSTSEIPKIVKSSSRCLSETDNTNDTKDKTQQLHMPAG
ALFDISNFMGSYSGNIDHVVNEKRRILGRNSASSFKRPRSSRFITPISTNRQSSAGVPKP
PPTQITSCRTKLSAYYPFQHKRKTWKEYFGGPPCFNCLAEHIIDEVKLMDAKGAEKYKFH
NMNTGAEEFQKLLIACGASLTYATKEWVNNHYKWIVWKLGSLERCYPTKAAGKFLTVANV
LDELKYRYDREVNNGHRSAIKKIVEGNALPSLMMVLCISAIYSHPDVNKLEAVGTDGNEN
SIENKSLLAAKRNMPAHIELTDGWYALEASLDVALSEQLQKRKLFIGQKLRIWGASLCGW
TGPVSFHEASGTVKLMVHVNGSYRARWDDPLGFCKHVGPPLAFKCIKASGGRVPRTLVGV
ARIYPVLYKERLPDGSSIVRSERMERKALQLYHQRVSKIAEDIMSEQDENCASTDDSEEG
AKICKMLEQAAEPEVMMAGLTSEQMISFSSYQAKQKEARQNEVAKKVENALEVAGLSSRD
VTPFLKVRVTSLAHKISATKTINKEGLITIWNPTEKQKADLVEGQVYIATGLLPSAHCTN
ILYLHARGSSTMWKPLASAQAADFQPFFTPRKAVELSLIGEVPLASEFDIAGVVLHVGEV
YLCSNQKRQWLFLTDGSKFISASQSTEQDDCLLAVSFSCSSASDDGAFFSYALSGNTVGF
SNLVKRQKDQTRHIWVAEATQNSTFTLSHEISKKSHLKEAATCAEKWASSSFDKIQQLKE
KVLCIIGDSGG
Download sequence
Identical sequences Traes_3AS_F565F74EF.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]