SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3DL_01DA17F63.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3DL_01DA17F63.1
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.94e-18
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 2 Region: 413-525
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000053
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 226-320
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000804
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_3DL_01DA17F63.1
Sequence length 531
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3DL_scaff_6951469:1219:5637:1 gene:Traes_3DL_01DA17F63 transcript:Traes_3DL_01DA17F63.1 description:""
Sequence
MSDPCECCQIKLKFLRQINGNFVHSLVIPEWFVSQFGGKVWRTVKLESPDGNVYDVGVTE
NMNRTILKSGWASFVDANKIEENYSLMFHYLGNARFKVTIFDSSGKQKASCCARMGTAAS
DVRNPSTFDVDNSSSSCGGGTQSSPSERSDSDGSQKESSYGYKKSAKKAAISDSSEGLSA
EDSLSRDNLVESYDVQEHLNDYVLSGKCDLTVAQEAKIQALVEKIRSEIPVLVVQMKKTS
ANFGNLIIRKDYALKYFPCEATNIILQLPRKNKEWKCRFNPGRRNLYLGYFVHDNCVQEG
DICLFQPIAKVKEGRFTVIVHLLHKESVHRSPGGTAGMTHTPTDGRTGAKTSLTARVKEE
PATDGEDMSSLGHKEDGDNSEGAPETPFILPDRASITPAQEQKVWKKVEAIESTVPVYVA
ILNKCNVSRKYGITITMGKQYVSRYLEKQYFTGHRGKKNVISLVLQREGKSRTWDTELRR
GTDRMRICKGWVAFVRGNRLRVGDLCLFKLMESEEPLKMMVYIIRREKCLD
Download sequence
Identical sequences W5D7F2
Traes_3DL_01DA17F63.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]