SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_3DL_85B9A0C1E.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3DL_85B9A0C1E.1
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.06e-76
Family Acetyl-CoA synthetase-like 0.0000162
Further Details:      
 
Domain Number 2 Region: 588-889
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.3e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 380-444
Classification Level Classification E-value
Superfamily ACP-like 0.00000173
Family Peptidyl carrier domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_3DL_85B9A0C1E.1
Sequence length 947
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3DL_scaff_6952372:81:8254:-1 gene:Traes_3DL_85B9A0C1E transcript:Traes_3DL_85B9A0C1E.1 description:""
Sequence
MFTSGSTGRPKGVCGTEKGLLNRFLWMQRRNPLCSDDVLLFKTSVSFVDHLQEFLSAVLT
STTLVIPPIDWRANPTSLANLIKTYRISRMTIVPSLMEMILPAMEKNISCGYNSLKILVF
SGEILSLVLWKRVREILPETTVVNLYGTTEVSGDCTFFDCKDLPAILECEEITSVPIGFP
IANCEVVLVTHAGMADEGEICVSGACLFNGYLAEFLMSNHTEGSESSTYYKTGDYARRLK
AGELVFLGRKDRTVKNYGQRFSLEEVESTLKEHPAVSDAAVTFQSKGSPDYKAYLVFKNK
DGIVKDSLQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLHVKSLPLTSSGKVDYVKLS
SLECALEPCGNEQIKSGSGPVNPYLQVIKKAFCDTLLVDEVSEFDDFFTLGGNSISAAHA
AHKLEIDMRLLYIYPTPSKLLHALVVEDSNLVSPTDEPQPKKDLNVSTSIHGLFDLSAAN
ADDSYHGGKAQINGKRAHYQIAESYGDETDGQLNKYPFSSDDRYQVNDLYLDTGLKDRNS
VIGSQWILNFCLHKKWSIGRCNRFMHDDEGKLQLEDVCLHVSYNKRGYLQELWNIPLDSC
VDASPLLVLNNGMINIFIGSHSHLFLCIDGCNGSVRWSVKLEGRVECSAAITGDFSEVVV
GCYKGKIYFHDMLTGKLSWTVQTDGEVKMQPVVDRTRNLIWCGSYDHHLYALNYKDRCCA
YKVSCGGSIYGSPAVDMAHDRIYVACTSGLVTAISLEVPSFRIVWQYEAGAAIFSSLAID
HQSGNVVCCLVNGLVIALNSHGTVVWKATVGGPIFAGACVSCALPSQVLIPSRDGSLYSF
DITSGDLLWSYDVGDPITASAFVDEVLASRPSGASERFACICTSSGKVRVLGIRADAEQE
KDGYSLQEFAAMDLPGDIFSSPLMVGGRILVGCRDDRLHCLSITSHP
Download sequence
Identical sequences Traes_3DL_85B9A0C1E.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]