SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_4AS_3698CBB71.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4AS_3698CBB71.1
Domain Number 1 Region: 127-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-18
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 275-361
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000104
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_4AS_3698CBB71.1
Sequence length 386
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4AS_scaff_5930276:411:2451:-1 gene:Traes_4AS_3698CBB71 transcript:Traes_4AS_3698CBB71.1 description:""
Sequence
MCEPIAVRPFLTSPFLGGGVKKSIPEEESREARRCIYHRCTFERRGRGRRRKEEEEGFAT
WHGIHGIVGSFFFLFLPLPLALPSSQAPVSPPSQPAAAERGPGDRHRRLLSATPLRPETG
EMEGFEFFQIILDNSSSRLRLPDKFTRVLLDGGKPQEVKLQEAGHGRRFWDVKVVLDADG
HMYLGRGWEQFARAHDLRLGYFLVFSFDGDAVLTVKVFDVSMCRRHYQHDGDTSSGSSSD
GDSGSSNASDGGSGGNNWSLAEMDVEDGPTGQFSAMLRKCNLGMKQEQYLNVPVDFQLAH
GYAERSKVELRMRGKSWLVHLKHNPKTGGRPRASFRYGWHQFCVDNALGEGDTCFFRALR
QGSAGGGGEDHLLKVEVRRRDGSFLV
Download sequence
Identical sequences W5DWS6
Traes_4AS_3698CBB71.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]