SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_4AS_EB18E9A3D.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4AS_EB18E9A3D.1
Domain Number 1 Region: 295-585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-72
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 9-117
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000486
Family Universal stress protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_4AS_EB18E9A3D.1
Sequence length 656
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4AS_scaff_5994175:14095:17110:-1 gene:Traes_4AS_EB18E9A3D transcript:Traes_4AS_EB18E9A3D.1 description:""
Sequence
MAGEGVGRCILVGLHMDAVGKELLQWALNQAARSGDRVVAVHIYRKSDLCKTNALTLIRT
LDDYLAEYEAICSKKDIVLVGRVTPGSSIQKVLVKEAKLCAAMVVVIGANKKYSFGGSTG
LAKYCARKLPATTSVVAIQGGKAIFVREAPRPPLGAEPKPVLRTLLHPSVGMEPKVIIPN
PNRRSARSMDFDATGCGQCAAPPQPKKPCDDHDAADAKALVVRVPAPEQKLGWPLLRRAP
PAAQATTRDHETTRKQSVVHWVMSLPRRSSPSASPEPAQEGLAAELRRALAGAPSRCRWF
RYEELYDATNHFSPGNLVGKGAHSRVYRGGLASGQRVAIKLCRASAEASKDFLREVDIIT
KLQHGRIVPLVGVCVEGPNLISVYRYLPRGSLEDNLHGKKRSKPALPWEKRYRAAVGVAE
ALSYVHSGCSRPVIHRDVKSSNILLTDDFEPQLSDFGLAIWAPSSPSSLTHSDVVGTFGY
LAPEYFMYGKVTDKVDVYAFGVVLLELLTGRRPITGDGSPKGHHQSLVMWATPILNGGDI
SDLLDPSLDVKHDEVEVRRMGVAASLCLGRSARLRPPISQILSILRGEEDATSLAASEPD
CVVDDETYPAANVRSHLGLALLDVEDAESISSTEHTNLSPLEEYLRERCSRSSSFD
Download sequence
Identical sequences Traes_4AS_EB18E9A3D.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]