SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_4BS_28D2F8459.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4BS_28D2F8459.1
Domain Number 1 Region: 273-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000249
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 38-191
Classification Level Classification E-value
Superfamily POZ domain 0.0000000337
Family BTB/POZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_4BS_28D2F8459.1
Sequence length 601
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4BS_scaff_4959618:6063:10642:-1 gene:Traes_4BS_28D2F8459 transcript:Traes_4BS_28D2F8459.1 description:""
Sequence
METSTVTYSSSSPPPSSSPPQQQAEQAADLDAVSLGRLSANLERLLDPAFLSCADADVVL
ADDAAAVVGVHRCILAARSSFFLDHFSNKLPDPAAAGEKEKEKEKERPRLELAELVPGGR
HIGRDALVAVLGYLYTGRLKPPPRDSAVCVDERCPHEACRPAIDFVVESTYAAAGFQISE
LVSLFQRRLSDFVSIALVEDIVPIVHVASTCQLHELLSQCIQRVAGSSVDSRYLEKELPD
EAFAKVKEYRRYSLHDDSDEFILDPEHAKKVRNIHKALDCDDVDLVGLLLQESAITLDDA
LAIHYAAAYCEPKVLALLLKLDPAGDCVNVNLKNDSGYTPLHLACMRREPQILLSLIEKG
ASVVERTHDGRDALTICKRLTTEKDCNKKLEKCKERSKAYLCIDILEQEIKRKSFIFEEL
LSAEVSVATPLLVDNFHMRLINLENRVAFARIFFPSEAKLVMRIAQADSTEEFAGLTSAN
FNKLKEVDLNETPTMQNRRLRERLDALTKTVELGRKYFPHCSDVLDKFLMEESTDLHFLE
SGSAEDQYTRRTRFSELKEDVRKAFSKDKAVAAIASSTSSSSPRGDGKVSRHGHKKARLS
R
Download sequence
Identical sequences W5E9T4
Traes_4BS_28D2F8459.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]