SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_4BS_9E4FBF387.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4BS_9E4FBF387.1
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-17
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 191-298
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-16
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_4BS_9E4FBF387.1
Sequence length 429
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4BS_scaff_4938122:5535:8169:-1 gene:Traes_4BS_9E4FBF387 transcript:Traes_4BS_9E4FBF387.1 description:""
Sequence
MNEDCENCAFWRDHYYWEHMGDEKKQFSAVAKGDFKNSIRIPRELSTHLRSRISDTIKLS
APNGRAYDVVVTWEFGELVIRSGWDAFVTAHHIEENDTFLFIYHGNSNFEIHIFNSHGCE
KMASCFQSPSEIFGIFPPSEPCDHHVLNGQAAPNPRHVQTQVEFDYTMSTGCHLTKSQDE
KVVEIARKIRSEIPLYVAIMKKLNVNVKDCSINIPLRLVRHLKEEAGSAIIKLEAPDGNI
YNVRASKHSEDQVVLQSDWDAFVAANHIQLNDLLIFHSKGKTRLKVLALDPSGCEKNSSC
LDTKNFSKTGEGSVWITDARPCTVEIIDLTSSDDDRTEREDAGRSSGRRKQVPGSHAKAR
KMASASSPSTKSGPDTHKLKHPISNNDNLQGPYRPPYILARGITLTGCVEKKVQEKVQAI
GSELPIYVA
Download sequence
Identical sequences Traes_4BS_9E4FBF387.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]