SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_4DL_AEF5AB905.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4DL_AEF5AB905.2
Domain Number 1 Region: 164-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-18
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 311-397
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000706
Family B3 DNA binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_4DL_AEF5AB905.2
Sequence length 422
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4DL_scaff_14400158:2286:4220:-1 gene:Traes_4DL_AEF5AB905 transcript:Traes_4DL_AEF5AB905.2 description:""
Sequence
MGEKWMLPIYVKRDQMDATIYCRPSLSLPEPIAVRHVRAHCRPALSHISISRWRGQEVYP
GPVGGIQRSEAFSIYHRCTFERRGRGRRRKEEEEGFATWHGIHGIVGSFFFLFLPLPLAL
PSSIASSSLSTLAASRCRERGGRHRRLLSATPLRPGEMEGFEFFQIILDNSSSRLRLPDK
FTRVLLDGGKPQEVKLREAGHRRRFWDVKVVLDADGHMYLGRGWEQFARAHGLRLGYFLV
FSYDGDAVLTVKVFDVSMCRRHYQHDGDTSSGSSSDGDSGSSNTSDGGGGGNNWSLAEMD
VEDGPTGQFSAMLRKCNLGMKQEQYLNVPVDFQLAHGYAERSKVELRMRGKSWLVHLKHN
PKTGGRSRASFRYGWHQFCVDNALGVGDTCFFRALRQGSAGGGGEDHLLKVEVRKRDGSF
LV
Download sequence
Identical sequences W5EKQ7
Traes_4DL_AEF5AB905.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]