SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_5BL_4780FA980.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5BL_4780FA980.2
Domain Number 1 Region: 299-383
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 8-55,90-123,184-211
Classification Level Classification E-value
Superfamily POZ domain 7.85e-18
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5BL_4780FA980.2
Sequence length 495
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5BL_scaff_10849105:3695:6051:1 gene:Traes_5BL_4780FA980 transcript:Traes_5BL_4780FA980.2 description:""
Sequence
MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPS
HQPPPPPLNWPNAGGGSGGGGGGGSRGGSGGAPATPELVIPVSSIRYEVLVLVLQFLYSG
QASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQVGKQLESM
VKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAK
SPLAGGGASAPRSPFLTHHYLPINNGPSSAADRDHKIRRMRRALDAADIELVKLMVMGEG
LDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVSPDMVSVLL
DHHADPNARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTR
DDGGGGDGGGAGGSDGGNFGRGDADDSLVSLTMNSTLMYQGQEMAAPPVAGEARNKGANN
GRASPSNLYFPNGFP
Download sequence
Identical sequences Traes_5BL_4780FA980.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]