SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_5BS_4AD5BD777.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5BS_4AD5BD777.2
Domain Number 1 Region: 303-411
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 155-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5BS_4AD5BD777.2
Sequence length 1070
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5BS_scaff_2290024:973:9207:1 gene:Traes_5BS_4AD5BD777 transcript:Traes_5BS_4AD5BD777.2 description:""
Sequence
MHQTPPYPGAAEGAVPSSSMDAPLTEERRAARRVRRRVCSSGLPTSLNHGESDNAQETST
HSTEISSSDCYTQLSSESSDEGCENRSSGHRRKRRKTSVISSASEQSGQDSPSACESLES
DDVQITPGKDYVLPQRCDLSDAEKNRVVALIKEIKAKVTVFVAIMFRSYSSYVTIPKEYA
AVHFPHESATITLRSPGKNKKWHPRFYKKGTMIKLTGSWIHFVRDNDVHEGDICIFVPAK
GGKPFMFTVHLLRKETTDSQTEVSHESSECEDSHGQPPYILPYGARLSPSQRSAVQKKVD
SIQSEVPIYVSIMTKSNLGSRHMELSKRYAAEHLPHRNVTLMFQYMGKIWNINMLFHDRK
YPKRWYLIGGWSKFISDNSLRLGDICLFELKKDEKELTVIVHLLRKESIDHPSGGSPVLD
SNYVRASTMIASTVRVGEEPDDEEETASSGREEQGFHDEPIEHNHSEGASKAHMPTAPCS
ESNASGISPSSEAREQAAGCSNKSFATEFPNKLSSTMEHNRIIHTDRAAASEVIGLSDYR
IHNSCDSIDSQGGESLAVQQQSSPSPEIGNSVNRDSSSVTGQNGVALQSLVRVTGQQVGD
AEKEVNASGGENTLADLRHLEPQNAAAVPSQAALPMPKEKTDTQTNRSAQPDVAQAQPPQ
GEVEQAGLSGVASPQPLQPAQLAQGEAEQDLSGVALPSQPETRPSISGFVKTRSNLETQS
VQQSIAPVQFPQEQAGLSGVASAQPLVPEMRPSNPLSNIPLERAHPNRGQSSRQPEVAAG
PAQPAQLFPVPSMMFNHPPIGDEPLKNELHRLRLHIDSLDKIYELKQSQLQTECSQEIEK
IKQKYDLLLEERDSVHLEQMKTLDGLLEKVVFHQSLAADFRAKFISSSAAQAKAYSRPIH
QTPQASQQAPMRPPGVTSISPPVAWSSAGRPVVPGGAQPSQVDRPSTPASSQVPRPPLPS
TPVVRPPINPGNLVRTTGAPMPRVPPRGSHGVPSASAPHLQRRLPPRAHSTAPANQRQQQ
QQHATSVSPQSSHAVPPVSSSPLPPSSSQATHHGSSTRMDVDVVCLSDDE
Download sequence
Identical sequences Traes_5BS_4AD5BD777.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]