SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_5DS_485F1D5FD.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5DS_485F1D5FD.1
Domain Number 1 Region: 113-212
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-21
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 271-370
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-21
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 479-575
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-17
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 4 Region: 640-743
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-16
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5DS_485F1D5FD.1
Sequence length 754
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5DS_scaff_2753814:7005:11461:-1 gene:Traes_5DS_485F1D5FD transcript:Traes_5DS_485F1D5FD.1 description:""
Sequence
MSCFHLHLLNKLFKWDSFFNRRYDGTARTRPTISAGMVCICIYMYALFLWAWASLAFWLL
LCRSIGSWQRILITFVMAPDQDHEQDNRSGHSISSKSFQRCEGCDAHYYWCHMDDTQKYF
FKCMVGNFQEKMAIPQKFVQNFKGQISEVIKLEAPDGNIYNVQAIKDLNKIVLGSGWGVF
VRFYELKAGYFLVFRYIGDSHFKVLIFDFASCCEKEVFHVLMNCGPNAQEKDTRLDRSLL
GEKRCQNGGSSNSESHRRCEHCDVHFYWHHMDDRQKHFLRFMVGDFLHEMNIPEKFVNNF
RGRISKVMKLEAPDGNVYNIQVTNDLNKITLRSGWAAFASAYELKEHDLLVFSYTGNSHF
RVLIFDPSGCEKELFRIVMNHTPNVQKGGISHDQLFLKETRRRDGGSRDNNPRKTKKMTL
LDSPSPKSAEGVTSPEDTMNSSGPPETTEPRYVLATGCNLTTAQKAQIDTLVKKIRPVIP
FYITAMNKTSLSGSLVICKDYAAKYLPHEDQFITLCHPRKSNIWLDNLKVTTDGSGMLSA
GWSCFVLHNELRESDVCVFEVSKSAGEMTMVVHSLEGGHHLQGKEPESQNKCDYPVKGKA
IKEAESDHKHAESKSNYYYSKYAKGLNGEELEEIFRSALIQQGNVVYVTILGKNQVRIKN
NLLTFPEKFAAKHLVERSHDILLLRPNRSETWCARYYYHPEKQGFSYSSWTKFVRDNKLR
EGHVCVFELIKGVSKAMMIVHVFTKVDGRFVLLD
Download sequence
Identical sequences Traes_5DS_485F1D5FD.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]