SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_6AS_FDAA3C689.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_6AS_FDAA3C689.1
Domain Number 1 Region: 34-348
Classification Level Classification E-value
Superfamily SIS domain 2.89e-50
Family mono-SIS domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_6AS_FDAA3C689.1
Sequence length 349
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_6AS_scaff_4376226:4538:10351:1 gene:Traes_6AS_FDAA3C689 transcript:Traes_6AS_FDAA3C689.1 description:""
Sequence
MGSLPVLSPAECAPLPPEGTRATVAASDLAALFDAQRRHLDHFFDRLDMPQAAAFAQALL
DAPGAVFFTGVGKSGIVARKLAQTLASLGFARAGFLSPVDALHGDIGSVFPGDVLVLLSK
SGASDELLALAPCARAKGAKLISLTSAASGADCPLAAACDLNVHLPLQGEVCPFGLAPVT
STAIQMVFGDTVVAAIMEARRLTRDQYASNHPAGKIGKTLIFKVKDVMKKQNELPLCKEG
DMIMDQLTELTSKGCGCLLVVDDEYHLIGTFTDGDLRRTLKASGPAIFSLTVGEMCNRNP
RTITADAMAVEAMEKMESPPSPVQFLPVVDDKNVVSGIITLHGLVSAGL
Download sequence
Identical sequences W5GHH0
Traes_6AS_FDAA3C689.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]