SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7AS_B97F8CE3C.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7AS_B97F8CE3C.1
Domain Number 1 Region: 264-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 43-180
Classification Level Classification E-value
Superfamily POZ domain 0.000000165
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_7AS_B97F8CE3C.1
Sequence length 500
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7AS_scaff_4173923:1119:3805:-1 gene:Traes_7AS_B97F8CE3C transcript:Traes_7AS_B97F8CE3C.1 description:""
Sequence
MQLVNSSSYGDESTEQSLPINWAPESCAADAVADVEPLRRLSDNLATAFHSPDDFAFLAD
MCIAVPGAPDLHVHRYMLSVRSPFLRAFFARRASVEGNRLELWELLGEKVEVGYEALQLV
LEYLYSARFHVLPRPACVCVDMDGCAHVSCHPVISFMAQVLFVTFTFQITELTNYFQRHL
LDVLDDVEVGNLPLILSVANLCNKSCMKLLDRCLEMVVRSNLEMITLEKALPPDVMKQIT
DARLSLGLVSPEDKGFPKKHARRILRALDSSDVELVRMLLKEGQTNLDDAFALHYAVEHC
NSKITTELLDIAHANVNHRNPRGYTVLHIAARRRDPKILVSLLTKGARPSDLTFDGRKAI
QIAKRLTKHRDYFGITEEGKPSPKDRLCIEVLEQAERWDPQVGEASVSLARVGDCEPGKL
LYLENRVGLARIHFPVEARVAMDIAQLDGTSEFILGSSADPPPEIQQATVDLNETSLIMN
DEHLARMRALSKTGETQIIA
Download sequence
Identical sequences Traes_7AS_B97F8CE3C.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]