SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7AS_F5B4DA3F5.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7AS_F5B4DA3F5.2
Domain Number 1 Region: 13-266
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.01e-50
Family Acetyl-CoA synthetase-like 0.0000408
Further Details:      
 
Domain Number 2 Region: 492-774
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 284-348
Classification Level Classification E-value
Superfamily ACP-like 0.00000662
Family Peptidyl carrier domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_7AS_F5B4DA3F5.2
Sequence length 789
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7AS_scaff_4210625:4070:10781:-1 gene:Traes_7AS_F5B4DA3F5 transcript:Traes_7AS_F5B4DA3F5.2 description:""
Sequence
MEIILPTLEKNISYGYNSLKILVFSGEILSLVLWKRVREILPETTIINLYGTTEVSGDCT
FFDCKDLPAILEREEITSVPIGFPIANCEVFLVKHAGIAAEGEICVSGACLFYGYLAEFL
RSNHTEGSESSKYYKTGDYARRLKAGELVFLGRRDRSVKNYGQRFSLEEVESTLKEHPAV
SDAAVTFQSKGSPDYKAYLVFKNKDEIVKDSVQYREVNSSQDVMASIRSWLIKKVPPAMI
PSFFLHVKSLPLTSSGKVDYVKLSSLECASEPCGIEQIKSGSGPVNPYLQVIKKAFCDAL
LVDEVSEFDDFFTLGGNSISAAHAAHKLEIDMRLLYIYPTPSMLLHALVVEHSNLVSPTD
EPQPKKGLNVSTSIHGLFDPVAANVDDSYHGGKARINGKRAHYQIAGSYGNETDGQLNKY
PFSPDDRCQVNDLYLDTCLKYRNSVMGSQWILNFCLHKKWSIGRCNRFMHDDEGKLQLED
VCSHVSYNKRGYLQELWNIPLDSCVDASPLLVLNNGMINIFIGSHSHLFLCIDGCNGSVR
WSVKLEGRVECSAAITGDFSEVVVGCYKGKIYFHDMLTGKLSWTVQTDGEVKMQPVVDRT
RNLIWCGSYDHHLYALNYKDRCCAYKVSCGGSIYGSPAVDMAHDRIYVACTSGLVTAISL
EVPSFRIVWQYEAGAAIFSSLAIDHQSGNVVCCLVNGLVITLNSHGTVVWKATVGGPIFA
GACVSSALPSQVLIPSRDGSLYSFDITSGDLLWSYDVGDPITASAFVDEVLSSTPSGALE
RFACICTSS
Download sequence
Identical sequences Traes_7AS_F5B4DA3F5.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]