SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7BL_8CB1FDCD9.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7BL_8CB1FDCD9.2
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.98e-75
Family Acetyl-CoA synthetase-like 0.0000164
Further Details:      
 
Domain Number 2 Region: 588-888
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.12e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 380-441
Classification Level Classification E-value
Superfamily ACP-like 0.00000978
Family Peptidyl carrier domain 0.016
Further Details:      
 
Weak hits

Sequence:  Traes_7BL_8CB1FDCD9.2
Domain Number - Region: 916-943
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0491
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_7BL_8CB1FDCD9.2
Sequence length 945
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7BL_scaff_6748704:2269:10419:-1 gene:Traes_7BL_8CB1FDCD9 transcript:Traes_7BL_8CB1FDCD9.2 description:""
Sequence
MFTSGSTGRPKGVCGTEKGLLNRFLWMQRRNPLCSDDVLLFKTSVSFVDHLQEFLSAVLT
STTLVIPPNNWRANPASLANLIKAYRISRVTIVPSLMEIILPTLEKNISCGYNSLKILVF
SGEILSLVLWKRVREILPETTIINLYGTTEVSGDCTFFDCKDLPAILEREEITSVPIGFP
IANCEVFLVKHAGIAAEGEICVSGACLFNGYLAEFLRSNHTEGSESSTYYKTGDYARRLK
AGELVFLGRKDRSVKNYGQRFSLEEVESTLKEHPAVSGAAVTFQSKGSPDYKAYLVFKNK
DEIVKDSVQHREVNSSQDVMASIRSWLIKKVPPAMIPSFFLHVKSLPLTSSGKVDYVKLS
SLDCALEPCGIEQIKTESGPINPYLQVIKKAFRDALLVDEVSEFDDFFTLGGNSISAAHA
AHKLEIDMRLLYIYPTPSKLLHASVVEHSNLVSPTDDPQPKKGLNVSTSIHGLFDPFAAN
ADDSYHGGKARINGKRAHYQIAGSYGDETDGQLNKYPFSPDDRYQVNDFYLDTCLKDRNS
VMGSQWILNFCLHKKWSIGRCNRFMHDDEGKLQLEDVCSYVSYNKRGYLQELWNIPLDSC
VDASPLLVLNNGMINIFIGSHSHLFLCIDGCNGSVRWSVKLEGRVECSAAITGDFSEVVV
GCYKGKIYFHDMLTGKLSWTVQTDGEVKMQPVVDRTRNLIWCGSYDHYLYALNYKDRCCA
YKVSCGGSIYGSPAVDMAHDRIYVACTSGLVTAISLEVPSFRIVWQYEARAAIFSSLAID
HQSGNVVCCLVNGLVIALNSHGTVVWKATVGGPIFASACVSSALPSQVLIPSRDGSLYSF
DITSGDLLWSYDVGDPITASAFVDEVLASTPSGASERFACICTSSGKVRVLGIRADAEQE
KDGYSVQEFAAMDLPGDIFSSPLMVGGRIFVGCRDDRLHCLSITS
Download sequence
Identical sequences Traes_7BL_8CB1FDCD9.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]