SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7DL_11C20FC1B.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7DL_11C20FC1B.1
Domain Number 1 Region: 49-137,282-410
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.92e-24
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Domain Number 2 Region: 137-205,240-280
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.93e-17
Family Calcium ATPase, transduction domain A 0.0086
Further Details:      
 
Domain Number 3 Region: 404-439
Classification Level Classification E-value
Superfamily HAD-like 0.0000709
Family Meta-cation ATPase, catalytic domain P 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_7DL_11C20FC1B.1
Sequence length 512
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7DL_scaff_3390970:1199:3091:1 gene:Traes_7DL_11C20FC1B transcript:Traes_7DL_11C20FC1B.1 description:""
Sequence
MEQALHLLLLPPAPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRKPLKYPTNYISTTK
YNVLTFLPKAIFEQFRRVANLYFLLTAILSLTPVCPFSPVSMIAPLAFVVGLSMIKEALE
DWRRFMQDMKVNNRKVSVHKGDGEFEFRHWEDLCVGDVVKVEKDQFFPADLLLLSSSYED
GICYVETMNLDGETNLKLKRSLEVTLPLEEDETFKDFRGVIRCEDPNASLYTFIGNLDYE
RQVYALDPSQILLRDSKLRNTAFIYGVVIFTGHDSKVMQNSTESPSKRSRIEKKMDLIIY
ILFTVLVLISLISSIGFAVRIKLDLPRWWYLQPQNSNKLDDPTRPALSGIFHLITALILY
GYLIPISLYVSIEVVKVAQAHFINQDIHMFDEETGNTAQARTSNLNEELGQVHTILSDKT
GTLTCNQMDFLKCSIAGVSYGVRASEVERAAAKQMASGAADQDIPVQDVWESNEDEIQLV
EGVTFSVGKTQKSSIKGFSFEDDRLMQGHWTN
Download sequence
Identical sequences Traes_7DL_11C20FC1B.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]