SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Traes_7DS_F5DCD6740.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7DS_F5DCD6740.1
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.49e-74
Family Acetyl-CoA synthetase-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 589-873
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.77e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 382-444
Classification Level Classification E-value
Superfamily ACP-like 0.00000978
Family Peptidyl carrier domain 0.018
Further Details:      
 
Weak hits

Sequence:  Traes_7DS_F5DCD6740.1
Domain Number - Region: 916-943
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0334
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_7DS_F5DCD6740.1
Sequence length 948
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7DS_scaff_3333297:2577:11087:-1 gene:Traes_7DS_F5DCD6740 transcript:Traes_7DS_F5DCD6740.1 description:""
Sequence
MFTSGSTGRPKGVCGMEKGLLNRFLWMQRRNPLCSDDVLLFKTSVSFVDHLQEFLSAVLT
STTLVIPPIDWRANPTSLANLIKAYRISRMTIVPSLMEIILPTLEKNISCVYNSLKILVF
SGEILSLVLWKRVREILPETTIINLYGTTEVSGDCTFFDCKDLPGILEREEITSVPIGFP
IANCEVFLVTHAGIADEGEICVSGACLFNGYLAEFLSSNHTEGSVISTYYKTGDYARRLK
AGELVFLGRKDRTVKIYGQRFSLEEVESTLKEHPAVSDAALTFQSKGSPDYKAYLVFKNK
DGIVKDSLQYREVNSSQDIMASIRSWLIKKVPPAMIPSFFLHVKSLPLTSSGKVDYVKLS
SLECASEPCGIAQIKSGSGLVNPYLQVIKKAFCDALLVDEVSEFDDFFTLGGNSISAAHA
AHKLEIDMRLLYIYPTPFKLLDALIVDHSNLVSPTDEPQPKKGLDVSTSVHGLFDPIAAN
ADDGYHGGKARINGKRAHYQIAGSYGNETDGQLNKYPFSPDDRCQVNDLYLDTCLMDRNS
VMGSQWILNFCLHKKWSIGRCNRFMHDDEGKLQLEGVCSYVSYNKRGYLQELWNIPLDSC
VDASPLLVLNNGMINIFIGSHSHLFLCIDGCNGSVRWSVKLEGRVECSAAITGDFSEVVV
GCYKGKIYFHDMLTGKLSWTVQTDGEVKMQPVVDRTRSLIWCGSYDHHLYALNYKDRCCA
YKVSCGGSIYGSPAVDMAHDRIYVACTSGLVTAISLEVPSFRIVWQYEAGAAIFSSLAID
HQSGNVVCCLVNGLVIALNSHGTVVWKATVGGPIFAGACVSSALPSQVLISSRDGSLYSF
DITSGDLLWSYDVGDPITASAFVDEVLASTPSGSPERFACICTSSGKVRVLGIRADAEQE
KVGYSVQEFAAMDLPGDIFSSPLMVGGRIFVGCRDDRLHCLSITNPFN
Download sequence
Identical sequences W5IC98
Traes_7DS_F5DCD6740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]