SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378776794|ref|YP_005185231.1| from Legionella pneumophila subsp. pneumophila ATCC 43290

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378776794|ref|YP_005185231.1|
Domain Number 1 Region: 11-317
Classification Level Classification E-value
Superfamily SIS domain 1.62e-68
Family mono-SIS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378776794|ref|YP_005185231.1|
Sequence length 320
Comment polysialic acid capsule expression protein [Legionella pneumophila subsp. pneumophila ATCC 43290]
Sequence
MNFCTLGLAVIETEAQAVFELTQRIDEHFEKACELLLSCKGRIVVTGMGKSGHIANKLAS
TFSSTGSPAFFMHPGEASHGDLGMITRQDIVVAISNSGNTHEIVTLLPLLKRLEVPLITL
TGNKQSTLAKSADVNLDVSIKQEACPLGLAPTTSTTVSLVMGDALAISLLQARGFSAEDF
ALSHPGGALGKKLLLKIDDLCHTGEQLPLANENATVSDALIEVTNKKLGMTCVVDNHGYL
VGVYTDGDIRRTLTRQFNINTTLIKDVMTKNCRTISKGMLAAEALAIMQKYSITSLVVVE
NDNRPYAVLHLHDLLKAGVF
Download sequence
Identical sequences A0A128YX74 A0A1S8GHC2 A0A2J9NL93 G8UT17 Q5WY68 Q5ZX92
gi|52841076|ref|YP_094875.1| gi|148360514|ref|YP_001251721.1| gi|397666517|ref|YP_006508054.1| gi|378776794|ref|YP_005185231.1| gi|54293815|ref|YP_126230.1| gi|54296861|ref|YP_123230.1| WP_010946576.1.100609 WP_010946576.1.100881 WP_010946576.1.101326 WP_010946576.1.101385 WP_010946576.1.101551 WP_010946576.1.10160 WP_010946576.1.101751 WP_010946576.1.101869 WP_010946576.1.10234 WP_010946576.1.10632 WP_010946576.1.10829 WP_010946576.1.11317 WP_010946576.1.11666 WP_010946576.1.1173 WP_010946576.1.11786 WP_010946576.1.1188 WP_010946576.1.12035 WP_010946576.1.12039 WP_010946576.1.1206 WP_010946576.1.12661 WP_010946576.1.12916 WP_010946576.1.13050 WP_010946576.1.13961 WP_010946576.1.14160 WP_010946576.1.14235 WP_010946576.1.14270 WP_010946576.1.14396 WP_010946576.1.14762 WP_010946576.1.15016 WP_010946576.1.15769 WP_010946576.1.16040 WP_010946576.1.16078 WP_010946576.1.16593 WP_010946576.1.16601 WP_010946576.1.16626 WP_010946576.1.16748 WP_010946576.1.16962 WP_010946576.1.17092 WP_010946576.1.17351 WP_010946576.1.17430 WP_010946576.1.17548 WP_010946576.1.17681 WP_010946576.1.17809 WP_010946576.1.17841 WP_010946576.1.17857 WP_010946576.1.17948 WP_010946576.1.18568 WP_010946576.1.19186 WP_010946576.1.19321 WP_010946576.1.19554 WP_010946576.1.19781 WP_010946576.1.20369 WP_010946576.1.2062 WP_010946576.1.2085 WP_010946576.1.20993 WP_010946576.1.21168 WP_010946576.1.21466 WP_010946576.1.21493 WP_010946576.1.21504 WP_010946576.1.21543 WP_010946576.1.21849 WP_010946576.1.21924 WP_010946576.1.22039 WP_010946576.1.2239 WP_010946576.1.22734 WP_010946576.1.22766 WP_010946576.1.2333 WP_010946576.1.23459 WP_010946576.1.23866 WP_010946576.1.2394 WP_010946576.1.24053 WP_010946576.1.24295 WP_010946576.1.24333 WP_010946576.1.2441 WP_010946576.1.24636 WP_010946576.1.24659 WP_010946576.1.24790 WP_010946576.1.24881 WP_010946576.1.2526 WP_010946576.1.25399 WP_010946576.1.25422 WP_010946576.1.25566 WP_010946576.1.25619 WP_010946576.1.25858 WP_010946576.1.26718 WP_010946576.1.27038 WP_010946576.1.27113 WP_010946576.1.27354 WP_010946576.1.27501 WP_010946576.1.27538 WP_010946576.1.27674 WP_010946576.1.27676 WP_010946576.1.28020 WP_010946576.1.28040 WP_010946576.1.28346 WP_010946576.1.28686 WP_010946576.1.28721 WP_010946576.1.28782 WP_010946576.1.28814 WP_010946576.1.2919 WP_010946576.1.29318 WP_010946576.1.29425 WP_010946576.1.29598 WP_010946576.1.29717 WP_010946576.1.29802 WP_010946576.1.29930 WP_010946576.1.30240 WP_010946576.1.30351 WP_010946576.1.30513 WP_010946576.1.30578 WP_010946576.1.30583 WP_010946576.1.30653 WP_010946576.1.30717 WP_010946576.1.30822 WP_010946576.1.3115 WP_010946576.1.3122 WP_010946576.1.31291 WP_010946576.1.31301 WP_010946576.1.31669 WP_010946576.1.31862 WP_010946576.1.32367 WP_010946576.1.3258 WP_010946576.1.32608 WP_010946576.1.32615 WP_010946576.1.32659 WP_010946576.1.32970 WP_010946576.1.33232 WP_010946576.1.33479 WP_010946576.1.3365 WP_010946576.1.33708 WP_010946576.1.34167 WP_010946576.1.34228 WP_010946576.1.34246 WP_010946576.1.34463 WP_010946576.1.34671 WP_010946576.1.35082 WP_010946576.1.35118 WP_010946576.1.35787 WP_010946576.1.35792 WP_010946576.1.35807 WP_010946576.1.36016 WP_010946576.1.36350 WP_010946576.1.36420 WP_010946576.1.36520 WP_010946576.1.36556 WP_010946576.1.36691 WP_010946576.1.36852 WP_010946576.1.37078 WP_010946576.1.37108 WP_010946576.1.37161 WP_010946576.1.37274 WP_010946576.1.37322 WP_010946576.1.37616 WP_010946576.1.37678 WP_010946576.1.37757 WP_010946576.1.37792 WP_010946576.1.37932 WP_010946576.1.38133 WP_010946576.1.38174 WP_010946576.1.3819 WP_010946576.1.38414 WP_010946576.1.38634 WP_010946576.1.38679 WP_010946576.1.38809 WP_010946576.1.38919 WP_010946576.1.3933 WP_010946576.1.39582 WP_010946576.1.40024 WP_010946576.1.40151 WP_010946576.1.40375 WP_010946576.1.40835 WP_010946576.1.40870 WP_010946576.1.41061 WP_010946576.1.41185 WP_010946576.1.41194 WP_010946576.1.41378 WP_010946576.1.41396 WP_010946576.1.41414 WP_010946576.1.41486 WP_010946576.1.41585 WP_010946576.1.41639 WP_010946576.1.42405 WP_010946576.1.42431 WP_010946576.1.43145 WP_010946576.1.43838 WP_010946576.1.44619 WP_010946576.1.44696 WP_010946576.1.44866 WP_010946576.1.44947 WP_010946576.1.45024 WP_010946576.1.45039 WP_010946576.1.45368 WP_010946576.1.46042 WP_010946576.1.46096 WP_010946576.1.46375 WP_010946576.1.46948 WP_010946576.1.47329 WP_010946576.1.47341 WP_010946576.1.47557 WP_010946576.1.47638 WP_010946576.1.47725 WP_010946576.1.47823 WP_010946576.1.47956 WP_010946576.1.48346 WP_010946576.1.4842 WP_010946576.1.48466 WP_010946576.1.48523 WP_010946576.1.48881 WP_010946576.1.48987 WP_010946576.1.49404 WP_010946576.1.4947 WP_010946576.1.49562 WP_010946576.1.50306 WP_010946576.1.50379 WP_010946576.1.50772 WP_010946576.1.50792 WP_010946576.1.50842 WP_010946576.1.51024 WP_010946576.1.51153 WP_010946576.1.51257 WP_010946576.1.51428 WP_010946576.1.51685 WP_010946576.1.51956 WP_010946576.1.51958 WP_010946576.1.51991 WP_010946576.1.52283 WP_010946576.1.52439 WP_010946576.1.5252 WP_010946576.1.52625 WP_010946576.1.5268 WP_010946576.1.52706 WP_010946576.1.52723 WP_010946576.1.52787 WP_010946576.1.52905 WP_010946576.1.52911 WP_010946576.1.53134 WP_010946576.1.53250 WP_010946576.1.53261 WP_010946576.1.53443 WP_010946576.1.53474 WP_010946576.1.53602 WP_010946576.1.5363 WP_010946576.1.53669 WP_010946576.1.53795 WP_010946576.1.53844 WP_010946576.1.54355 WP_010946576.1.54450 WP_010946576.1.54472 WP_010946576.1.547 WP_010946576.1.54704 WP_010946576.1.54747 WP_010946576.1.54834 WP_010946576.1.55083 WP_010946576.1.55380 WP_010946576.1.5553 WP_010946576.1.56486 WP_010946576.1.5660 WP_010946576.1.56801 WP_010946576.1.56857 WP_010946576.1.57055 WP_010946576.1.57468 WP_010946576.1.57482 WP_010946576.1.57907 WP_010946576.1.58065 WP_010946576.1.58425 WP_010946576.1.58541 WP_010946576.1.58590 WP_010946576.1.58606 WP_010946576.1.5861 WP_010946576.1.58655 WP_010946576.1.58658 WP_010946576.1.58764 WP_010946576.1.58931 WP_010946576.1.59183 WP_010946576.1.59227 WP_010946576.1.59576 WP_010946576.1.59692 WP_010946576.1.59940 WP_010946576.1.60120 WP_010946576.1.60239 WP_010946576.1.6043 WP_010946576.1.60442 WP_010946576.1.60770 WP_010946576.1.61227 WP_010946576.1.61482 WP_010946576.1.61570 WP_010946576.1.61895 WP_010946576.1.62077 WP_010946576.1.62255 WP_010946576.1.62386 WP_010946576.1.6243 WP_010946576.1.62610 WP_010946576.1.62652 WP_010946576.1.62869 WP_010946576.1.63249 WP_010946576.1.63282 WP_010946576.1.63357 WP_010946576.1.636 WP_010946576.1.63686 WP_010946576.1.64049 WP_010946576.1.64298 WP_010946576.1.64335 WP_010946576.1.64388 WP_010946576.1.64512 WP_010946576.1.64624 WP_010946576.1.64714 WP_010946576.1.64856 WP_010946576.1.64936 WP_010946576.1.65356 WP_010946576.1.65444 WP_010946576.1.65604 WP_010946576.1.6601 WP_010946576.1.66058 WP_010946576.1.66209 WP_010946576.1.66299 WP_010946576.1.6641 WP_010946576.1.6663 WP_010946576.1.66827 WP_010946576.1.66942 WP_010946576.1.66949 WP_010946576.1.67291 WP_010946576.1.67348 WP_010946576.1.67448 WP_010946576.1.67497 WP_010946576.1.67503 WP_010946576.1.67763 WP_010946576.1.68412 WP_010946576.1.68702 WP_010946576.1.68780 WP_010946576.1.68977 WP_010946576.1.69197 WP_010946576.1.69332 WP_010946576.1.696 WP_010946576.1.69880 WP_010946576.1.70346 WP_010946576.1.70654 WP_010946576.1.7066 WP_010946576.1.70691 WP_010946576.1.70860 WP_010946576.1.7124 WP_010946576.1.71556 WP_010946576.1.71674 WP_010946576.1.7196 WP_010946576.1.72375 WP_010946576.1.72557 WP_010946576.1.72722 WP_010946576.1.728 WP_010946576.1.73029 WP_010946576.1.7313 WP_010946576.1.73276 WP_010946576.1.73409 WP_010946576.1.73575 WP_010946576.1.73915 WP_010946576.1.74003 WP_010946576.1.74052 WP_010946576.1.74197 WP_010946576.1.74371 WP_010946576.1.74412 WP_010946576.1.74438 WP_010946576.1.7452 WP_010946576.1.75016 WP_010946576.1.75242 WP_010946576.1.75285 WP_010946576.1.75353 WP_010946576.1.75911 WP_010946576.1.75926 WP_010946576.1.7619 WP_010946576.1.76246 WP_010946576.1.76298 WP_010946576.1.76893 WP_010946576.1.7695 WP_010946576.1.77106 WP_010946576.1.77227 WP_010946576.1.77360 WP_010946576.1.77472 WP_010946576.1.77695 WP_010946576.1.77829 WP_010946576.1.77852 WP_010946576.1.77866 WP_010946576.1.78342 WP_010946576.1.78899 WP_010946576.1.79027 WP_010946576.1.79030 WP_010946576.1.79209 WP_010946576.1.79331 WP_010946576.1.79384 WP_010946576.1.79423 WP_010946576.1.79768 WP_010946576.1.79852 WP_010946576.1.79957 WP_010946576.1.79998 WP_010946576.1.80041 WP_010946576.1.80208 WP_010946576.1.80246 WP_010946576.1.80459 WP_010946576.1.80464 WP_010946576.1.80678 WP_010946576.1.80679 WP_010946576.1.80733 WP_010946576.1.80817 WP_010946576.1.80844 WP_010946576.1.80921 WP_010946576.1.81040 WP_010946576.1.81762 WP_010946576.1.81849 WP_010946576.1.81970 WP_010946576.1.82004 WP_010946576.1.82012 WP_010946576.1.82765 WP_010946576.1.82883 WP_010946576.1.83017 WP_010946576.1.83062 WP_010946576.1.83114 WP_010946576.1.83499 WP_010946576.1.8363 WP_010946576.1.83658 WP_010946576.1.83690 WP_010946576.1.84032 WP_010946576.1.8407 WP_010946576.1.84081 WP_010946576.1.84310 WP_010946576.1.84341 WP_010946576.1.84649 WP_010946576.1.85643 WP_010946576.1.85655 WP_010946576.1.85699 WP_010946576.1.85818 WP_010946576.1.85821 WP_010946576.1.86050 WP_010946576.1.86175 WP_010946576.1.86349 WP_010946576.1.86462 WP_010946576.1.86607 WP_010946576.1.87014 WP_010946576.1.87029 WP_010946576.1.87225 WP_010946576.1.87431 WP_010946576.1.87629 WP_010946576.1.87656 WP_010946576.1.87917 WP_010946576.1.88023 WP_010946576.1.88081 WP_010946576.1.88271 WP_010946576.1.88601 WP_010946576.1.88749 WP_010946576.1.89129 WP_010946576.1.89135 WP_010946576.1.89155 WP_010946576.1.89171 WP_010946576.1.90392 WP_010946576.1.90650 WP_010946576.1.90718 WP_010946576.1.90773 WP_010946576.1.90915 WP_010946576.1.91040 WP_010946576.1.91256 WP_010946576.1.91480 WP_010946576.1.9248 WP_010946576.1.92599 WP_010946576.1.92683 WP_010946576.1.9284 WP_010946576.1.93162 WP_010946576.1.93200 WP_010946576.1.93993 WP_010946576.1.94044 WP_010946576.1.94262 WP_010946576.1.94448 WP_010946576.1.94483 WP_010946576.1.9449 WP_010946576.1.94508 WP_010946576.1.94611 WP_010946576.1.95613 WP_010946576.1.9567 WP_010946576.1.9568 WP_010946576.1.95686 WP_010946576.1.95895 WP_010946576.1.96018 WP_010946576.1.96198 WP_010946576.1.96370 WP_010946576.1.96522 WP_010946576.1.97528 WP_010946576.1.97598 WP_010946576.1.97635 WP_010946576.1.97638 WP_010946576.1.97848 WP_010946576.1.97870 WP_010946576.1.97946 WP_010946576.1.97957 WP_010946576.1.9807 WP_010946576.1.98134 WP_010946576.1.98163 WP_010946576.1.98470 WP_010946576.1.98579 WP_010946576.1.98839 WP_010946576.1.98841 WP_010946576.1.98916 WP_010946576.1.98928 WP_010946576.1.99113 WP_010946576.1.99481 WP_010946576.1.99514 WP_010946576.1.9953 WP_010946576.1.9955 WP_010946576.1.9970 WP_010946576.1.99767 WP_010946576.1.9980 WP_010946576.1.99870 WP_010946576.1.99939 YP_094875.1.86292 272624.lpg0840 297245.lpl0871 297246.lpp0902 400673.LPC_2455 gi|509150173|ref|YP_008062547.1| gi|397663398|ref|YP_006504936.1| gi|296106419|ref|YP_003618119.1| gi|470183044|ref|YP_007568919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]