SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378778875|ref|YP_005187317.1| from Legionella pneumophila subsp. pneumophila ATCC 43290

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378778875|ref|YP_005187317.1|
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily SIS domain 4.04e-44
Family mono-SIS domain 0.00000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378778875|ref|YP_005187317.1|
Sequence length 199
Comment phosphoheptose isomerase [Legionella pneumophila subsp. pneumophila ATCC 43290]
Sequence
MIQLEERVRHLFGVTIEAKISAADVLSGSIAKAGKLLVNCLLNDGKIFICASGGSSANCM
HFSSSMLNHFEVERPSLPVINLCADASCLSSFADEHHFGQVFARQIQALGQEQDVLLLLT
TSGNSDSMLQALHAASERGMDTIALSGRDGGVLANHMGPEDIEIRVASDSTALIRELHLF
ILHCFCDLIEQSLFGQVLG
Download sequence
Identical sequences A0A130CR05 A0A2J9NF11 G8UXG0 Q5WSF7 Q5ZR90
272624.lpg2993 297245.lpl2921 gi|52843186|ref|YP_096985.1| gi|397665611|ref|YP_006507149.1| gi|509152340|ref|YP_008064714.1| WP_010948677.1.100881 WP_010948677.1.101385 WP_010948677.1.10160 WP_010948677.1.101751 WP_010948677.1.101869 WP_010948677.1.10234 WP_010948677.1.11317 WP_010948677.1.11666 WP_010948677.1.1188 WP_010948677.1.12035 WP_010948677.1.12661 WP_010948677.1.13961 WP_010948677.1.14235 WP_010948677.1.14270 WP_010948677.1.14396 WP_010948677.1.14762 WP_010948677.1.15016 WP_010948677.1.16078 WP_010948677.1.16593 WP_010948677.1.16601 WP_010948677.1.16626 WP_010948677.1.16748 WP_010948677.1.16962 WP_010948677.1.17351 WP_010948677.1.17430 WP_010948677.1.17857 WP_010948677.1.18568 WP_010948677.1.19186 WP_010948677.1.19321 WP_010948677.1.19554 WP_010948677.1.20369 WP_010948677.1.2062 WP_010948677.1.2085 WP_010948677.1.20993 WP_010948677.1.21466 WP_010948677.1.21493 WP_010948677.1.21924 WP_010948677.1.22039 WP_010948677.1.2239 WP_010948677.1.22734 WP_010948677.1.22766 WP_010948677.1.2333 WP_010948677.1.23459 WP_010948677.1.2394 WP_010948677.1.24053 WP_010948677.1.24333 WP_010948677.1.2441 WP_010948677.1.24636 WP_010948677.1.24790 WP_010948677.1.24881 WP_010948677.1.2526 WP_010948677.1.25566 WP_010948677.1.26718 WP_010948677.1.27038 WP_010948677.1.27354 WP_010948677.1.27501 WP_010948677.1.27674 WP_010948677.1.28020 WP_010948677.1.28346 WP_010948677.1.28814 WP_010948677.1.29318 WP_010948677.1.29802 WP_010948677.1.29930 WP_010948677.1.30513 WP_010948677.1.30578 WP_010948677.1.30583 WP_010948677.1.30653 WP_010948677.1.30717 WP_010948677.1.30822 WP_010948677.1.31291 WP_010948677.1.31669 WP_010948677.1.31862 WP_010948677.1.32608 WP_010948677.1.32615 WP_010948677.1.32659 WP_010948677.1.33479 WP_010948677.1.3365 WP_010948677.1.34228 WP_010948677.1.35118 WP_010948677.1.35787 WP_010948677.1.36420 WP_010948677.1.36520 WP_010948677.1.36556 WP_010948677.1.36691 WP_010948677.1.36852 WP_010948677.1.37108 WP_010948677.1.37274 WP_010948677.1.37932 WP_010948677.1.38174 WP_010948677.1.3819 WP_010948677.1.38634 WP_010948677.1.38679 WP_010948677.1.38919 WP_010948677.1.3933 WP_010948677.1.40024 WP_010948677.1.40151 WP_010948677.1.40375 WP_010948677.1.40870 WP_010948677.1.41061 WP_010948677.1.41185 WP_010948677.1.41194 WP_010948677.1.41378 WP_010948677.1.41486 WP_010948677.1.41639 WP_010948677.1.42405 WP_010948677.1.44619 WP_010948677.1.44696 WP_010948677.1.44866 WP_010948677.1.45024 WP_010948677.1.45368 WP_010948677.1.46042 WP_010948677.1.46096 WP_010948677.1.47341 WP_010948677.1.47557 WP_010948677.1.47823 WP_010948677.1.47956 WP_010948677.1.48346 WP_010948677.1.48881 WP_010948677.1.50772 WP_010948677.1.51024 WP_010948677.1.51153 WP_010948677.1.51257 WP_010948677.1.51428 WP_010948677.1.51685 WP_010948677.1.51956 WP_010948677.1.51958 WP_010948677.1.52283 WP_010948677.1.5252 WP_010948677.1.5268 WP_010948677.1.52706 WP_010948677.1.52723 WP_010948677.1.52787 WP_010948677.1.52905 WP_010948677.1.53134 WP_010948677.1.53250 WP_010948677.1.53261 WP_010948677.1.53474 WP_010948677.1.53602 WP_010948677.1.53669 WP_010948677.1.53795 WP_010948677.1.53844 WP_010948677.1.54355 WP_010948677.1.54704 WP_010948677.1.54834 WP_010948677.1.55083 WP_010948677.1.56486 WP_010948677.1.5660 WP_010948677.1.56857 WP_010948677.1.57055 WP_010948677.1.57468 WP_010948677.1.57482 WP_010948677.1.58541 WP_010948677.1.58606 WP_010948677.1.58658 WP_010948677.1.58764 WP_010948677.1.58931 WP_010948677.1.59227 WP_010948677.1.59576 WP_010948677.1.60120 WP_010948677.1.60239 WP_010948677.1.60770 WP_010948677.1.61227 WP_010948677.1.61570 WP_010948677.1.61895 WP_010948677.1.62077 WP_010948677.1.62610 WP_010948677.1.62869 WP_010948677.1.63282 WP_010948677.1.636 WP_010948677.1.64049 WP_010948677.1.64298 WP_010948677.1.64335 WP_010948677.1.64388 WP_010948677.1.64512 WP_010948677.1.64624 WP_010948677.1.64856 WP_010948677.1.65444 WP_010948677.1.66058 WP_010948677.1.66209 WP_010948677.1.66299 WP_010948677.1.67448 WP_010948677.1.67503 WP_010948677.1.67763 WP_010948677.1.68151 WP_010948677.1.68412 WP_010948677.1.68702 WP_010948677.1.69197 WP_010948677.1.69332 WP_010948677.1.70346 WP_010948677.1.70654 WP_010948677.1.7066 WP_010948677.1.70691 WP_010948677.1.70860 WP_010948677.1.7124 WP_010948677.1.71556 WP_010948677.1.7196 WP_010948677.1.72375 WP_010948677.1.73029 WP_010948677.1.7313 WP_010948677.1.73915 WP_010948677.1.74003 WP_010948677.1.74371 WP_010948677.1.74412 WP_010948677.1.74438 WP_010948677.1.7452 WP_010948677.1.75242 WP_010948677.1.75353 WP_010948677.1.75911 WP_010948677.1.7619 WP_010948677.1.76298 WP_010948677.1.76893 WP_010948677.1.77472 WP_010948677.1.77695 WP_010948677.1.77829 WP_010948677.1.77852 WP_010948677.1.77866 WP_010948677.1.78342 WP_010948677.1.79027 WP_010948677.1.79030 WP_010948677.1.79209 WP_010948677.1.79998 WP_010948677.1.80041 WP_010948677.1.80459 WP_010948677.1.80678 WP_010948677.1.80733 WP_010948677.1.80817 WP_010948677.1.81762 WP_010948677.1.81970 WP_010948677.1.82765 WP_010948677.1.83017 WP_010948677.1.83062 WP_010948677.1.83114 WP_010948677.1.83499 WP_010948677.1.8363 WP_010948677.1.83658 WP_010948677.1.84081 WP_010948677.1.84341 WP_010948677.1.84474 WP_010948677.1.84649 WP_010948677.1.85643 WP_010948677.1.85655 WP_010948677.1.85699 WP_010948677.1.85818 WP_010948677.1.86050 WP_010948677.1.86349 WP_010948677.1.86607 WP_010948677.1.87014 WP_010948677.1.87225 WP_010948677.1.87431 WP_010948677.1.87629 WP_010948677.1.87656 WP_010948677.1.87917 WP_010948677.1.88023 WP_010948677.1.88081 WP_010948677.1.88271 WP_010948677.1.88601 WP_010948677.1.89135 WP_010948677.1.89155 WP_010948677.1.89171 WP_010948677.1.90392 WP_010948677.1.90650 WP_010948677.1.90915 WP_010948677.1.91256 WP_010948677.1.91480 WP_010948677.1.92683 WP_010948677.1.93162 WP_010948677.1.93200 WP_010948677.1.93993 WP_010948677.1.94044 WP_010948677.1.94448 WP_010948677.1.9449 WP_010948677.1.94508 WP_010948677.1.94611 WP_010948677.1.9567 WP_010948677.1.9568 WP_010948677.1.96018 WP_010948677.1.96198 WP_010948677.1.96522 WP_010948677.1.97528 WP_010948677.1.97598 WP_010948677.1.97635 WP_010948677.1.97638 WP_010948677.1.97957 WP_010948677.1.9807 WP_010948677.1.98134 WP_010948677.1.98163 WP_010948677.1.98470 WP_010948677.1.98839 WP_010948677.1.98928 WP_010948677.1.99113 WP_010948677.1.99514 WP_010948677.1.9953 WP_010948677.1.99870 WP_010948677.1.99939 YP_096985.1.86292 gi|378778875|ref|YP_005187317.1| gi|54295831|ref|YP_128246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]