SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463156|ref|YP_007738968.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463156|ref|YP_007738968.1|
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 7.06e-28
Family Ribosome-binding factor A, RbfA 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478463156|ref|YP_007738968.1|
Sequence length 123
Comment ribosome-binding factor A [Chlamydia trachomatis L3/404/LN]
Sequence
MAENRRMKKVNAMLREAIAKVILKDVKHPKISNRWITITRVSLSRDLQSACVYVSIMPHE
NSQEETLAALKASAGFIAFQASKDLVLKYFPDLNFYVEDIFSPQDHIESLLLKIAEQDKK
TNP
Download sequence
Identical sequences A0A0E9FWD8 B0B9K3 B0BB82 O84097
gi|527320710|ref|YP_008346909.1| gi|389858665|ref|YP_006360906.1| gi|389857792|ref|YP_006360034.1| gi|478453231|ref|YP_007717393.1| gi|478451418|ref|YP_007714724.1| gi|527319791|ref|YP_008345991.1| gi|527325617|ref|YP_008351810.1| gi|166154316|ref|YP_001654434.1| gi|478467653|ref|YP_007742526.1| gi|385241457|ref|YP_005809297.1| gi|478464954|ref|YP_007741636.1| gi|166155191|ref|YP_001653446.1| gi|478463156|ref|YP_007738968.1| gi|478472154|ref|YP_007732721.1| gi|478428230|ref|YP_007540670.1| gi|482545453|ref|YP_007851371.1| gi|478461343|ref|YP_007736293.1| gi|478473961|ref|YP_007730037.1| gi|478457744|ref|YP_007730929.1| gi|478447816|ref|YP_007721850.1| gi|385244181|ref|YP_005812025.1| gi|339625747|ref|YP_004717226.1| gi|385239607|ref|YP_005807449.1| gi|527327466|ref|YP_008353657.1| gi|385240527|ref|YP_005808368.1| gi|478462257|ref|YP_007738078.1| gi|471328270|ref|YP_007539795.1| gi|478470362|ref|YP_007729003.1| gi|478446925|ref|YP_007715613.1| gi|478464054|ref|YP_007740746.1| gi|385245993|ref|YP_005814815.1| NP_219598.1.57406 WP_009871443.1.100466 WP_009871443.1.100644 WP_009871443.1.100883 WP_009871443.1.101362 WP_009871443.1.101735 WP_009871443.1.102133 WP_009871443.1.11148 WP_009871443.1.11717 WP_009871443.1.11732 WP_009871443.1.13674 WP_009871443.1.13766 WP_009871443.1.13837 WP_009871443.1.1409 WP_009871443.1.14786 WP_009871443.1.14984 WP_009871443.1.15381 WP_009871443.1.17082 WP_009871443.1.18643 WP_009871443.1.1923 WP_009871443.1.19304 WP_009871443.1.20022 WP_009871443.1.20093 WP_009871443.1.22210 WP_009871443.1.25195 WP_009871443.1.25246 WP_009871443.1.27753 WP_009871443.1.27980 WP_009871443.1.28239 WP_009871443.1.29171 WP_009871443.1.30792 WP_009871443.1.31373 WP_009871443.1.32156 WP_009871443.1.32801 WP_009871443.1.32856 WP_009871443.1.34934 WP_009871443.1.35043 WP_009871443.1.36244 WP_009871443.1.36518 WP_009871443.1.3661 WP_009871443.1.37417 WP_009871443.1.37673 WP_009871443.1.37956 WP_009871443.1.38181 WP_009871443.1.38504 WP_009871443.1.38794 WP_009871443.1.38813 WP_009871443.1.39258 WP_009871443.1.40272 WP_009871443.1.40464 WP_009871443.1.40808 WP_009871443.1.4187 WP_009871443.1.4264 WP_009871443.1.42718 WP_009871443.1.44223 WP_009871443.1.45552 WP_009871443.1.48551 WP_009871443.1.48923 WP_009871443.1.4939 WP_009871443.1.49465 WP_009871443.1.5036 WP_009871443.1.51159 WP_009871443.1.51530 WP_009871443.1.52091 WP_009871443.1.53299 WP_009871443.1.5416 WP_009871443.1.55117 WP_009871443.1.57520 WP_009871443.1.57533 WP_009871443.1.58046 WP_009871443.1.58308 WP_009871443.1.5967 WP_009871443.1.60427 WP_009871443.1.60937 WP_009871443.1.61004 WP_009871443.1.62239 WP_009871443.1.62489 WP_009871443.1.62510 WP_009871443.1.64162 WP_009871443.1.65391 WP_009871443.1.66489 WP_009871443.1.67104 WP_009871443.1.67250 WP_009871443.1.69355 WP_009871443.1.69519 WP_009871443.1.69991 WP_009871443.1.71307 WP_009871443.1.71619 WP_009871443.1.72034 WP_009871443.1.72442 WP_009871443.1.74323 WP_009871443.1.74635 WP_009871443.1.75470 WP_009871443.1.77153 WP_009871443.1.77651 WP_009871443.1.78375 WP_009871443.1.79775 WP_009871443.1.83642 WP_009871443.1.85256 WP_009871443.1.85365 WP_009871443.1.86066 WP_009871443.1.87079 WP_009871443.1.87298 WP_009871443.1.87666 WP_009871443.1.88177 WP_009871443.1.88937 WP_009871443.1.9107 WP_009871443.1.93216 WP_009871443.1.9343 WP_009871443.1.95142 WP_009871443.1.96955 WP_009871443.1.97423 WP_009871443.1.97602 WP_009871443.1.99598 YP_001654434.1.27483 gi|385245067|ref|YP_005813890.1| gi|478466753|ref|YP_007718285.1| gi|478452319|ref|YP_007720067.1| gi|385243301|ref|YP_005811147.1| gi|527321663|ref|YP_008347861.1| gi|478454124|ref|YP_007716503.1| gi|478449618|ref|YP_007719175.1| gi|478460448|ref|YP_007735399.1| gi|389859542|ref|YP_006361782.1| 272561.CT095 471472.CTL0350 471473.CTLon_0346 gi|527326545|ref|YP_008352737.1| gi|478469462|ref|YP_007722742.1| gi|478459547|ref|YP_007733615.1| gi|478450518|ref|YP_007720960.1| gi|478455935|ref|YP_007726318.1| gi|527323558|ref|YP_008349754.1| gi|527328393|ref|YP_008354583.1| gi|478455025|ref|YP_007727215.1| gi|478456832|ref|YP_007725425.1| gi|482546395|ref|YP_007852311.1| gi|478473058|ref|YP_007734506.1| gi|527322600|ref|YP_008348797.1| gi|15604814|ref|NP_219598.1| gi|527324693|ref|YP_008350887.1| gi|527318835|ref|YP_008345036.1| gi|385242383|ref|YP_005810222.1| gi|527317910|ref|YP_008344112.1| gi|386262451|ref|YP_005815730.1| gi|478471253|ref|YP_007739856.1| gi|478474863|ref|YP_007724532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]