SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463397|ref|YP_007739209.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463397|ref|YP_007739209.1|
Domain Number 1 Region: 25-108
Classification Level Classification E-value
Superfamily HPr-like 7.85e-22
Family HPr-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478463397|ref|YP_007739209.1|
Sequence length 109
Comment bifunctional PTS system fructose-specific transporter subunit IIA/HPr protein [Chlamydia trachomatis L3/404/LN]
Sequence
MSGGNDSVLHRPVEAPLMEDGELSAVFTIRNPSGIHVRPAGTIVKLFEGEECEATLTYLG
KTVNARSVMSILMLGASYNGEVAVHIKGPSASRVMQKLSEVFNSGFGEL
Download sequence
Identical sequences A0A0E9AUD0 A0A0H3MBZ8
gi|478448059|ref|YP_007722093.1| gi|478449858|ref|YP_007719415.1| gi|527326783|ref|YP_008352975.1| gi|478450759|ref|YP_007721201.1| gi|482545699|ref|YP_007851617.1| gi|478470602|ref|YP_007729243.1| gi|478464294|ref|YP_007740986.1| gi|166154548|ref|YP_001654666.1| gi|527321900|ref|YP_008348098.1| 471472.CTL0591 471473.CTLon_0588 gi|478462498|ref|YP_007738319.1| gi|482546642|ref|YP_007852558.1| gi|478466993|ref|YP_007718525.1| gi|478454364|ref|YP_007716743.1| gi|527318153|ref|YP_008344355.1| gi|478465194|ref|YP_007741876.1| gi|527328635|ref|YP_008354825.1| gi|478452559|ref|YP_007720307.1| gi|478451659|ref|YP_007714965.1| gi|478471493|ref|YP_007740096.1| gi|166155423|ref|YP_001653678.1| gi|527323803|ref|YP_008349999.1| gi|478463397|ref|YP_007739209.1| gi|527325862|ref|YP_008352055.1| gi|478453472|ref|YP_007717634.1| WP_009873737.1.100883 WP_009873737.1.101735 WP_009873737.1.11148 WP_009873737.1.11732 WP_009873737.1.17082 WP_009873737.1.18643 WP_009873737.1.22210 WP_009873737.1.25195 WP_009873737.1.27753 WP_009873737.1.27980 WP_009873737.1.32801 WP_009873737.1.38181 WP_009873737.1.38794 WP_009873737.1.40464 WP_009873737.1.40808 WP_009873737.1.42718 WP_009873737.1.45552 WP_009873737.1.48923 WP_009873737.1.49465 WP_009873737.1.51159 WP_009873737.1.53299 WP_009873737.1.5416 WP_009873737.1.58046 WP_009873737.1.58308 WP_009873737.1.5967 WP_009873737.1.60427 WP_009873737.1.61004 WP_009873737.1.62489 WP_009873737.1.64162 WP_009873737.1.71307 WP_009873737.1.79775 WP_009873737.1.83642 WP_009873737.1.85365 WP_009873737.1.97423 WP_009873737.1.99598 YP_001654666.1.27483 gi|478469703|ref|YP_007722983.1| gi|478467894|ref|YP_007742767.1| gi|478447167|ref|YP_007715855.1| gi|527327710|ref|YP_008353901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]