SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463430|ref|YP_007739242.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463430|ref|YP_007739242.1|
Domain Number 1 Region: 3-354
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 9.68e-115
Family Chorismate synthase, AroC 0.000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478463430|ref|YP_007739242.1|
Sequence length 357
Comment chorismate synthase [Chlamydia trachomatis L3/404/LN]
Sequence
MHNQYGSIFSITTWGESHGPAIGVVIDGCPAGLSLSPEDFLPAMARRRPGQLHTSPRQEP
DLVTILSGVYQNKTTGTPISLLIENKDVSSSSYEHLQHCYRPGHAQFAYEGKYGFADNRG
GGRASARETASRVAAGVIAKKILLSQGIETLAFLSGFGTLESKNYPKLSDSLIQQVHTSP
FYTLLPQEEIQNLLLLNPDDSFGGVVSFITSPLPIGLGEPVFGKLPALLAAGMMSIPAAK
GFEIGAGFSSSQMTGSAYLDAFIADESGVSLQSNRCGGALGGISIGQPLEGRVAFKPTSS
IKKPCSSVLKDGTPIAYRTPNQGRHDPCVAIRAVAVVEAMLDLTLVDLLLQHRCTQL
Download sequence
Identical sequences A0A0E9AWL5 B0B7T7 B0BC02
gi|527327745|ref|YP_008353936.1| gi|339626039|ref|YP_004717518.1| gi|478448092|ref|YP_007722126.1| gi|527318188|ref|YP_008344390.1| gi|478465227|ref|YP_007741909.1| gi|527323838|ref|YP_008350034.1| gi|482545733|ref|YP_007851651.1| gi|478470635|ref|YP_007729276.1| gi|482546676|ref|YP_007852592.1| gi|478469736|ref|YP_007723016.1| gi|527328670|ref|YP_008354860.1| gi|478451692|ref|YP_007714998.1| gi|478452592|ref|YP_007720340.1| 471472.CTL0622 471473.CTLon_0620 gi|527321935|ref|YP_008348133.1| gi|478463430|ref|YP_007739242.1| gi|478464327|ref|YP_007741019.1| gi|478447200|ref|YP_007715888.1| gi|166155454|ref|YP_001653709.1| gi|527319109|ref|YP_008345310.1| gi|527325897|ref|YP_008352090.1| WP_009873760.1.100883 WP_009873760.1.101735 WP_009873760.1.11148 WP_009873760.1.11732 WP_009873760.1.17082 WP_009873760.1.18643 WP_009873760.1.22210 WP_009873760.1.25195 WP_009873760.1.27753 WP_009873760.1.27980 WP_009873760.1.32801 WP_009873760.1.38181 WP_009873760.1.38794 WP_009873760.1.40464 WP_009873760.1.40808 WP_009873760.1.42718 WP_009873760.1.45552 WP_009873760.1.48923 WP_009873760.1.49465 WP_009873760.1.51159 WP_009873760.1.53299 WP_009873760.1.5416 WP_009873760.1.58046 WP_009873760.1.58308 WP_009873760.1.5967 WP_009873760.1.60427 WP_009873760.1.61004 WP_009873760.1.62489 WP_009873760.1.64162 WP_009873760.1.67104 WP_009873760.1.71307 WP_009873760.1.79775 WP_009873760.1.83642 WP_009873760.1.85365 WP_009873760.1.95142 WP_009873760.1.97423 WP_009873760.1.99598 YP_001654697.1.27483 gi|478467026|ref|YP_007718558.1| gi|527326818|ref|YP_008353010.1| gi|527324972|ref|YP_008351166.1| gi|166154579|ref|YP_001654697.1| gi|478449891|ref|YP_007719448.1| gi|478450792|ref|YP_007721234.1| gi|478471526|ref|YP_007740129.1| gi|478453505|ref|YP_007717667.1| gi|478454397|ref|YP_007716776.1| gi|478462531|ref|YP_007738352.1| gi|478467927|ref|YP_007742800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]