SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463533|ref|YP_007739345.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463533|ref|YP_007739345.1|
Domain Number 1 Region: 215-349
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.01e-22
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 144-214
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000438
Family Heme-binding PAS domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478463533|ref|YP_007739345.1|
Sequence length 352
Comment sensory histidine kinase AtoS [Chlamydia trachomatis L3/404/LN]
Sequence
MPKIDTCDSCVSNTELLAIRTRVTQSYNEAQTILSSIPDGIFLLSESGEILICNPQARAI
LGIPKDIQLVTRMFHDFFPDTFFGFSVQEALEKEVPPKTIRLTLSQELSQKEVEVFVRKN
ISHGFLFLLIRDRSDYRQLEQAIEKYRSISELGKIAATLAHEIRNPLTSISGFATLLKEE
LSSERHQRMLNVIIEGTRSLNSLVSSMLEYTKIQPLNLRSIDLQDFFSSLIPELSLTFPS
CTFRRTILSPIQRSIDPDRLRCVIWNLVKNAVEASDEEIFLELHEKGFSVINTGTLPPNI
QEKLFIPFFTTKPQGNGLGLAEAHKIMRLHGGDLVVSTQDNRTTFTILWTPA
Download sequence
Identical sequences A0A0E9G2N6
gi|478470738|ref|YP_007729379.1| gi|478467129|ref|YP_007718661.1| gi|478463533|ref|YP_007739345.1| gi|478465330|ref|YP_007742012.1| gi|166155556|ref|YP_001653811.1| WP_012263659.1.101735 WP_012263659.1.18643 WP_012263659.1.25195 WP_012263659.1.27753 WP_012263659.1.38794 WP_012263659.1.40464 WP_012263659.1.42718 WP_012263659.1.45552 WP_012263659.1.48923 WP_012263659.1.49465 WP_012263659.1.51159 WP_012263659.1.53299 WP_012263659.1.5416 WP_012263659.1.58308 WP_012263659.1.5967 WP_012263659.1.64162 WP_012263659.1.79775 WP_012263659.1.97423 gi|478454500|ref|YP_007716879.1| gi|478449994|ref|YP_007719551.1| gi|478450895|ref|YP_007721337.1| gi|478469839|ref|YP_007723119.1| gi|478452694|ref|YP_007720442.1| gi|478462634|ref|YP_007738455.1| gi|478451795|ref|YP_007715101.1| gi|478468030|ref|YP_007742903.1| gi|478471629|ref|YP_007740232.1| gi|478448196|ref|YP_007722230.1| 471473.CTLon_0723 gi|478453608|ref|YP_007717770.1| gi|478464430|ref|YP_007741122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]