SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463686|ref|YP_007739498.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478463686|ref|YP_007739498.1|
Domain Number - Region: 93-222
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0141
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0075
Further Details:      
 
Domain Number - Region: 310-347
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0759
Family Flavin-binding PAS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478463686|ref|YP_007739498.1|
Sequence length 419
Comment hypothetical protein L3404_00647 [Chlamydia trachomatis L3/404/LN]
Sequence
MTRGFLNKRRVLEKCRTAKQKIHYCISRYFHYLPPVLAILLPIGSWPFLSEQQWWCGSFL
FPVVSSLGWLFAIGRRERQLRAAAGQLLEAKIRKLTEQDEGLKNIRETIEKRQKETDRLK
LHNDKLVEQLGQAREVFIQAKGRYDHMEELSRRLKEENQQLQMQLEAAVRERNEKILENQ
ELLQELKETLAYQQELHDEYQATFVEQHSMLDKRQAYIGNLEAKVQDLMCELRNLLQLEM
GAKTNLPGKPVASRDVVAQLVLEFRKIVFRVETTEAADSLTALRYTRTDPSAHNYSLACR
QLFDGLREENLGMLFIYAPFAQRVLFANALFNDWTGYGLEDFLNRESDVVLEGFAQWERD
LLTESRVERSGKIVIKTKAFGATPFYYCVVTLDKGPFAQHILGVLYPAKASFFTNLSYI
Download sequence
Identical sequences A0A0E9DLW2
gi|478462787|ref|YP_007738608.1| gi|478470891|ref|YP_007729532.1| gi|478448349|ref|YP_007722383.1| gi|478467282|ref|YP_007718814.1| gi|478453761|ref|YP_007717923.1| gi|478450147|ref|YP_007719704.1| gi|478451948|ref|YP_007715254.1| gi|478471782|ref|YP_007740385.1| gi|478469992|ref|YP_007723272.1| gi|478452847|ref|YP_007720595.1| gi|478464583|ref|YP_007741275.1| gi|478447457|ref|YP_007716145.1| gi|478468183|ref|YP_007743056.1| gi|478465483|ref|YP_007742165.1| gi|478454653|ref|YP_007717032.1| gi|478463686|ref|YP_007739498.1| gi|478451048|ref|YP_007721490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]