SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463700|ref|YP_007739512.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463700|ref|YP_007739512.1|
Domain Number 1 Region: 118-212
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.55e-18
Family PhoB-like 0.0098
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily CheY-like 0.0000119
Family CheY-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478463700|ref|YP_007739512.1|
Sequence length 227
Comment DNA-binding transcriptional regulator BasR [Chlamydia trachomatis L3/404/LN]
Sequence
MAGPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSP
KSLEGSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQHSLHSVPESI
RFGPNVFYVLKLTVETPEGSVHLTPSESGILKRLLINKGQLCLRKHLLEEIKNHAKAIVA
RNVDVHIASLRKKLGAYGSRIVTLRGVGYLFSDDGDKKFSQQDTKLS
Download sequence
Identical sequences A0A0E9ASX3 A0A0H3MDW1
gi|478447471|ref|YP_007716159.1| gi|478448363|ref|YP_007722397.1| gi|478452861|ref|YP_007720609.1| gi|478467296|ref|YP_007718828.1| gi|478471796|ref|YP_007740399.1| gi|482546959|ref|YP_007852875.1| gi|478465497|ref|YP_007742179.1| gi|478454667|ref|YP_007717046.1| gi|478450161|ref|YP_007719718.1| gi|166154845|ref|YP_001654963.1| gi|527324117|ref|YP_008350313.1| 471472.CTL0894 471473.CTLon_0888 gi|478462801|ref|YP_007738622.1| gi|478470006|ref|YP_007723286.1| gi|527326176|ref|YP_008352369.1| gi|478463700|ref|YP_007739512.1| gi|166155720|ref|YP_001653975.1| WP_009873961.1.100883 WP_009873961.1.101735 WP_009873961.1.11148 WP_009873961.1.11732 WP_009873961.1.17082 WP_009873961.1.18643 WP_009873961.1.22210 WP_009873961.1.25195 WP_009873961.1.27753 WP_009873961.1.27980 WP_009873961.1.38181 WP_009873961.1.38794 WP_009873961.1.40464 WP_009873961.1.40808 WP_009873961.1.42718 WP_009873961.1.45552 WP_009873961.1.48923 WP_009873961.1.49465 WP_009873961.1.51159 WP_009873961.1.53299 WP_009873961.1.5416 WP_009873961.1.58046 WP_009873961.1.58308 WP_009873961.1.5967 WP_009873961.1.62489 WP_009873961.1.64162 WP_009873961.1.71307 WP_009873961.1.79775 WP_009873961.1.83642 WP_009873961.1.85365 WP_009873961.1.97423 WP_009873961.1.99598 YP_001654963.1.27483 gi|527318467|ref|YP_008344669.1| gi|478470905|ref|YP_007729546.1| gi|478464597|ref|YP_007741289.1| gi|527327098|ref|YP_008353290.1| gi|478451062|ref|YP_007721504.1| gi|478451962|ref|YP_007715268.1| gi|478453775|ref|YP_007717937.1| gi|478468197|ref|YP_007743070.1| gi|482546016|ref|YP_007851934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]