SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463772|ref|YP_007739584.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463772|ref|YP_007739584.1|
Domain Number 1 Region: 3-241,487-533
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-67
Family Tandem AAA-ATPase domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 710-935
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 8.89e-56
Family Helical scaffold and wing domains of SecA 0.0000969
Further Details:      
 
Domain Number 3 Region: 536-707
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-46
Family Tandem AAA-ATPase domain 0.00000866
Further Details:      
 
Domain Number 4 Region: 354-378,421-487
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 5.75e-27
Family Pre-protein crosslinking domain of SecA 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478463772|ref|YP_007739584.1|
Sequence length 969
Comment preprotein translocase subunit SecA [Chlamydia trachomatis L3/404/LN]
Sequence
MMDFLKRFFGSSQERILKRFQKLVEEVNACDEKFSSLSDDELREKTPQLKQRYQDGESLD
KLLPEAYGVVKNVCRRLAGTPVEVSGYHQQWDMVPYDVQILGAIAMHKGFITEMQTGEGK
TLTAVMPLYLNALTGKPVHLVTVNDYLAQRDCEWVGSVLRWLGLTTGVLVSGSPPEKRKA
IYQCDVVYGTASEFGFDYLRDNSIATRKEEQVGRGFYFAIIDEIDSVLIDEARTPLIISG
PGEKHNPVYFELKDRVAELVYFQREMCNHIAIEARKVLDPFLGTDVLPKDKKVMEAISEA
CRALWLVSKGMPLNRVLRRVREHPDLRAMIDKWDVFYHAEQNKEECLEKLSSLYIVVDEH
NNDFELTDKGMLQWIEKIGGAAEDFVMMDMGHEYALIEEDATLSPADKLNRKIAVSEKDT
QRKARAHGLRQLLRAHLLMEKDIDYIVRDDQIVIIDEHTGRPQPGRRFSEGLHQAIEAKE
HVTIRKESQTFATVTLQNFFRLYEKLAGMTGTAITESREFKEIYSLYVLQVPTFKPCLRI
DHNDAFYMTEREKYQAIVAEIISAHRSGKPILIGTESVEVSEKLSRILRQNRINHTVLNA
KNHAQEAEIIAGAGKVGAVTVATNMAGRGTDIKLDEEAVAAGGLYVIGTSRHQSRRIDRQ
LRGRCARLGDPGAAKFFLSFEDRLMRLFASPKLNTLIRHFRPPEGEAMSDPMFDRLIETA
QKRVEGRNYTIRKHTLEYDDVMNKQRQTIYAFRNDVLHAEDLFVVAKEQIEHVALALAFL
ILKDAHADHCSLPKIEEWLSYSFPVKLDDQEIRRLGDVDAVADYIGDLLIEAFDVKFSAM
LAEFTEIIGSAANAQGICNDILRSVIISHIDEEWKVHLVDMDLLRSEVGLRSVGQKDPLI
EFKNESFLLFEGLIRDIRIAIVKHLFALELSLTRSDRPDNAIPTVATAFHNHDNFRPMEL
TIVGEEEES
Download sequence
Identical sequences A0A0E9E1L1 B0B8S7 B0BAF6
WP_009873306.1.100883 WP_009873306.1.101735 WP_009873306.1.11148 WP_009873306.1.17082 WP_009873306.1.18643 WP_009873306.1.22210 WP_009873306.1.25195 WP_009873306.1.27753 WP_009873306.1.38794 WP_009873306.1.40464 WP_009873306.1.42718 WP_009873306.1.45552 WP_009873306.1.48923 WP_009873306.1.49465 WP_009873306.1.51159 WP_009873306.1.53299 WP_009873306.1.5416 WP_009873306.1.58046 WP_009873306.1.58308 WP_009873306.1.5967 WP_009873306.1.61004 WP_009873306.1.62489 WP_009873306.1.64162 WP_009873306.1.71307 WP_009873306.1.79775 WP_009873306.1.83642 WP_009873306.1.85365 WP_009873306.1.97423 WP_009873306.1.99598 YP_001654161.1.27483 gi|478447543|ref|YP_007716231.1| gi|482546101|ref|YP_007852017.1| gi|478452935|ref|YP_007720683.1| gi|478448436|ref|YP_007722470.1| gi|478467369|ref|YP_007718901.1| gi|527327174|ref|YP_008353366.1| gi|478470978|ref|YP_007729619.1| gi|478451135|ref|YP_007721577.1| gi|478465570|ref|YP_007742252.1| gi|478462874|ref|YP_007738695.1| gi|482545159|ref|YP_007851077.1| gi|527324193|ref|YP_008350389.1| gi|478454740|ref|YP_007717119.1| gi|478453848|ref|YP_007718010.1| gi|478450234|ref|YP_007719791.1| gi|478464670|ref|YP_007741362.1| gi|527329025|ref|YP_008355215.1| gi|478470078|ref|YP_007723358.1| gi|478452035|ref|YP_007715341.1| gi|166154043|ref|YP_001654161.1| gi|166154918|ref|YP_001653173.1| gi|478463772|ref|YP_007739584.1| gi|527318543|ref|YP_008344745.1| gi|478471869|ref|YP_007740472.1| gi|478468269|ref|YP_007743142.1| 471472.CTL0070 471473.CTLon_0070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]