SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478463304|ref|YP_007739116.1| from Chlamydia trachomatis L3/404/LN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478463304|ref|YP_007739116.1|
Domain Number 1 Region: 196-428
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.45e-71
Family CAT-like 0.0000332
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily Single hybrid motif 4.45e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00029
Further Details:      
 
Domain Number 3 Region: 140-183
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000000667
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478463304|ref|YP_007739116.1|
Sequence length 429
Comment branched-chain alpha-keto acid dehydrogenase subunit E2 [Chlamydia trachomatis L3/404/LN]
Sequence
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP
SITMMGFRPEPPLATPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIIKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGSTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
Download sequence
Identical sequences A0A0E9DWM5 A0A0H3MBZ6
gi|527318980|ref|YP_008345181.1| gi|478471401|ref|YP_007740004.1| gi|478467802|ref|YP_007742675.1| gi|478449766|ref|YP_007719323.1| gi|478452467|ref|YP_007720215.1| gi|482545606|ref|YP_007851524.1| gi|478469611|ref|YP_007722891.1| gi|527321806|ref|YP_008348004.1| gi|478464202|ref|YP_007740894.1| gi|527327617|ref|YP_008353808.1| gi|478447074|ref|YP_007715762.1| gi|478470510|ref|YP_007729151.1| gi|527323708|ref|YP_008349904.1| gi|527325767|ref|YP_008351960.1| gi|478450667|ref|YP_007721109.1| gi|478451567|ref|YP_007714873.1| gi|339625906|ref|YP_004717385.1| gi|527324843|ref|YP_008351037.1| 471472.CTL0499 471473.CTLon_0495 gi|527326689|ref|YP_008352881.1| gi|478465102|ref|YP_007741784.1| gi|166155333|ref|YP_001653588.1| gi|478463304|ref|YP_007739116.1| gi|166154458|ref|YP_001654576.1| gi|478462405|ref|YP_007738226.1| gi|478447966|ref|YP_007722000.1| gi|478466901|ref|YP_007718433.1| gi|527318059|ref|YP_008344261.1| gi|482546549|ref|YP_007852465.1| gi|478453380|ref|YP_007717542.1| gi|478454272|ref|YP_007716651.1| WP_009873669.1.100883 WP_009873669.1.101735 WP_009873669.1.11148 WP_009873669.1.11732 WP_009873669.1.17082 WP_009873669.1.18643 WP_009873669.1.22210 WP_009873669.1.25195 WP_009873669.1.27753 WP_009873669.1.27980 WP_009873669.1.32801 WP_009873669.1.38181 WP_009873669.1.38794 WP_009873669.1.40464 WP_009873669.1.40808 WP_009873669.1.42718 WP_009873669.1.45552 WP_009873669.1.48923 WP_009873669.1.49465 WP_009873669.1.51159 WP_009873669.1.53299 WP_009873669.1.5416 WP_009873669.1.58046 WP_009873669.1.58308 WP_009873669.1.5967 WP_009873669.1.60427 WP_009873669.1.62489 WP_009873669.1.64162 WP_009873669.1.67104 WP_009873669.1.71307 WP_009873669.1.79775 WP_009873669.1.83642 WP_009873669.1.85365 WP_009873669.1.95142 WP_009873669.1.97423 WP_009873669.1.99598 YP_001654576.1.27483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]