SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478687257|ref|YP_007744067.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478687257|ref|YP_007744067.1|
Domain Number 1 Region: 120-250
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.07e-18
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 46-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-17
Family GntR-like transcriptional regulators 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478687257|ref|YP_007744067.1|
Sequence length 251
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MEHALPRAATPGAPGHPAETLRPRVPVQPTAEDRAHGEPPAPRTPLRRTSVRGQVLDGLR
AALVAGDLTPGDVYSAPGLAERFGVSATPVREAMQQLAVEGAVEVVPNRGFRVIERDARE
LAELAEVRALIEVPVMLRLAHSVPADRWTALRPLAEETVAAAETGDRARYADSDRAFHSA
VLGLGGNRQLTTVAADLHRRAQWPLVTGPLSRRRTDLVADAAQHLALLEALAGRDLPAVQ
TLVREHFAGAR
Download sequence
Identical sequences A0A1C4NC00
gi|478687257|ref|YP_007744067.1| WP_015506870.1.19862 WP_015506870.1.69503 WP_015506870.1.71906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]