SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478687430|ref|YP_007744240.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478687430|ref|YP_007744240.1|
Domain Number 1 Region: 103-236
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.51e-21
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.17e-17
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478687430|ref|YP_007744240.1|
Sequence length 247
Comment Transcriptional regulator [Streptomyces albus J1074]
Sequence
MAAEWRPVRQSRTHELVLERIEEQVVAGELKAGDRLPPERELAPVLGVSRSALREALRVL
ETIGVLVAHAGRGPDAGARIVRNPDDALGRLLRLHVALGSYNLHDVLEARVVLERSSFEA
AATHASAEDLAEAEETLRRMQEPDVTVPEFNDLDTSFHVQIARSSGNQLTSTLTSAVRES
VRPLILEALEAAEDWPATAAALNAEHTALLTLVREGNGPAAADLAEQHIRGFHGTLVPDT
DPSPSGD
Download sequence
Identical sequences A0A0X3X6C1 A0A126XY30 A0A1C4SAF4 D6BCC6
gi|478687430|ref|YP_007744240.1| WP_003951509.1.17225 WP_003951509.1.19862 WP_003951509.1.25010 WP_003951509.1.29512 WP_003951509.1.3281 WP_003951509.1.50088 WP_003951509.1.51302 WP_003951509.1.52204 WP_003951509.1.52805 WP_003951509.1.62881 WP_003951509.1.69503 WP_003951509.1.7575 WP_003951509.1.77676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]