SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478687616|ref|YP_007744426.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478687616|ref|YP_007744426.1|
Domain Number 1 Region: 72-201
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.15e-24
Family GntR ligand-binding domain-like 0.009
Further Details:      
 
Domain Number 2 Region: 6-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.47e-20
Family GntR-like transcriptional regulators 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478687616|ref|YP_007744426.1|
Sequence length 228
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MGIPAQSVCTAIREDIVSGVHERGSRLTEEQLARRYGVSRVPVREALRTLEAEGFVVTRR
HAGACVAEPTEQEAADLLEIRMLLEPLGAARAARRRTEAHLKVLRGLVRLGQERARLGEG
EDLRSLGAWFHETLAQASGSPGLTALLTQLRQKVTWMYAVDPPAAPAESWAEHGAIVDAV
ARGDAERARALTAQHAERATAVHRLRFGSRTTGVRTSQHVVNIPGGRN
Download sequence
Identical sequences gi|478687616|ref|YP_007744426.1| WP_015506978.1.19862 WP_015506978.1.69503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]