SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478689207|ref|YP_007746017.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478689207|ref|YP_007746017.1|
Domain Number 1 Region: 97-224
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.62e-29
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 8-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.79e-20
Family GntR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478689207|ref|YP_007746017.1|
Sequence length 235
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MTDDALRPMGRTRLYEQVLERLRAYAAEHRLAAGDRLPAERDLAQRLGVSRASVKQAVVV
LEVQGLVETRHGGGTYLLRDTLDHEPVERLVERRRRLPDVLEAREALETKLAELAATRRT
ETDLTALRAALAHMAGEIASGGHGEEGDRLFHAAVTEAGHSPLLAEFMASLTDQITESRR
ESLRQPGRPDRSLAQHHAILDAIEAGEAKRAAAAMRRHVRTVAKVRLLEWEPGER
Download sequence
Identical sequences A0A0X3WJF5 A0A126Y2Z8 A0A1C4IJP6 A0A1C4K366 A0A1C4QB90 A0A2A2UAM4 A0A2H9ZFS2 D6AXD3
gi|478689207|ref|YP_007746017.1| WP_003949721.1.17225 WP_003949721.1.19862 WP_003949721.1.25010 WP_003949721.1.29512 WP_003949721.1.40734 WP_003949721.1.50088 WP_003949721.1.51302 WP_003949721.1.52204 WP_003949721.1.52668 WP_003949721.1.52805 WP_003949721.1.62881 WP_003949721.1.69503 WP_003949721.1.71458 WP_003949721.1.71906 WP_003949721.1.7575 WP_003949721.1.77676 WP_003949721.1.90031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]