SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478689322|ref|YP_007746132.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478689322|ref|YP_007746132.1|
Domain Number 1 Region: 13-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.35e-18
Family GntR-like transcriptional regulators 0.033
Further Details:      
 
Domain Number 2 Region: 88-221
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000126
Family GntR ligand-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478689322|ref|YP_007746132.1|
Sequence length 230
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MCATRENSAHAVTRSTLRQQIAGALRDEVLAGRLHPGQEFTVKEIAEQYGVSATPVREAL
VDLSAQGLLDSVQHRGFRVHEFSVADYRAMVEARGLIADAMFSGLGHRTPGDPGRYLAVR
RRGEEAARAASAGDLNVLIGYDLRFWQELCSLFGNPYLSDFAYRLRLQSWVCSVPYLRRQ
DDLRGRLWTGHGALIDALAHQRYPEAQAIIAAYNADSLAFIEELAGPGAR
Download sequence
Identical sequences A0A126Y3E3 A0A1C4I681 A0A2H9ZG08 D6AWA9
gi|478689322|ref|YP_007746132.1| WP_003949606.1.17225 WP_003949606.1.19862 WP_003949606.1.25010 WP_003949606.1.29512 WP_003949606.1.69503 WP_003949606.1.71906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]