SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478689932|ref|YP_007746742.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478689932|ref|YP_007746742.1|
Domain Number 1 Region: 78-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-28
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.55e-17
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478689932|ref|YP_007746742.1|
Sequence length 220
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MTDKLTGAAARQHVADSIRHALRSGDLVPGQRLVENDLAAAYGATRGAVREALQDLAAEE
ILEIVPRRGARVRTVSVEEAVQITECRSALEQLCAGKAATLATDDQRAELARIGVDMRQA
VADGAWEAYSALNQRLHELVIEASGQEVARRTLGRLNGPMVRYQFRLALRPGRPARSLPQ
HLAIIEAVVGRDPEAAGRAAAAHLDDVIEQLRSSAAPSPT
Download sequence
Identical sequences A0A0H1B3N1 A0A0S1UPR9 A0A0X3WG29 A0A1C4KMV2 A0A2H9ZHQ3 D6B8F6
gi|478689932|ref|YP_007746742.1| WP_003948976.1.19862 WP_003948976.1.23992 WP_003948976.1.31976 WP_003948976.1.3281 WP_003948976.1.40734 WP_003948976.1.51302 WP_003948976.1.52204 WP_003948976.1.52668 WP_003948976.1.62881 WP_003948976.1.69503 WP_003948976.1.71458 WP_003948976.1.73990 WP_003948976.1.7575 WP_003948976.1.90031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]