SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478690253|ref|YP_007747063.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478690253|ref|YP_007747063.1|
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-17
Family GntR-like transcriptional regulators 0.027
Further Details:      
 
Domain Number 2 Region: 74-207
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000000602
Family GntR ligand-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478690253|ref|YP_007747063.1|
Sequence length 210
Comment Transcriptional regulator, GntR family [Streptomyces albus J1074]
Sequence
MAVRSVVEQATQVLRRAILTGALAPGAEYSLRELAGMLDISFIPIREALRTLEGEGLVVM
RPGRSAVVAPLGLDDLRGIYRLRRALEPEIAARSCLLLSEAELDRLAERAAGSGAVAGTD
DDPHVFHLALLAPAATTWDIRMLTPLWRAGERYVRIGFGRTGPGPAGHRRDGAAHGELVA
AFRTRDPATVSAAVERDLARTEKIALAALT
Download sequence
Identical sequences A0A126YBB2
WP_015507723.1.19862 WP_015507723.1.23992 WP_015507723.1.29512 WP_015507723.1.69503 gi|478690253|ref|YP_007747063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]