SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478691215|ref|YP_007748025.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478691215|ref|YP_007748025.1|
Domain Number 1 Region: 78-191
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.42e-20
Family GntR ligand-binding domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.9e-19
Family GntR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478691215|ref|YP_007748025.1|
Sequence length 207
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MTAPVVHSLREQIREHIVDGIVSGRWKPGERIVERRIAVELEVSQTPVREALRELETLRL
IESAPNKGVRVRDLTAADLEEIYPVRAGLEQIAAELAAPRLAADVSVLEPSVAALYEADR
LADGESQVRHTVAFHRELVRAAGNSVLLHTWEGLGIEVFTALSIRWLGTHQQAYAEEHQA
LVDAFRAQDPDIGHLVKSHVLGCAPRA
Download sequence
Identical sequences A0A0D6WNW8 A0A0H1AJB3 A0A0S1UU60 A0A0X3XC61 A0A126Y9B7 A0A1C4NE44 A0A1C4NHA1 A0A1C4RRU3 A0A209BLH0 A0A2A2UN63 A0A2H9ZKZ5 D6AXU8 V4IK17
WP_003947677.1.17225 WP_003947677.1.19862 WP_003947677.1.23992 WP_003947677.1.25010 WP_003947677.1.29512 WP_003947677.1.31976 WP_003947677.1.32510 WP_003947677.1.3281 WP_003947677.1.36028 WP_003947677.1.37677 WP_003947677.1.38292 WP_003947677.1.40734 WP_003947677.1.43113 WP_003947677.1.50088 WP_003947677.1.51302 WP_003947677.1.52204 WP_003947677.1.52668 WP_003947677.1.52805 WP_003947677.1.62881 WP_003947677.1.69503 WP_003947677.1.71458 WP_003947677.1.71906 WP_003947677.1.73990 WP_003947677.1.7575 WP_003947677.1.77676 WP_003947677.1.87353 WP_003947677.1.90031 gi|478691215|ref|YP_007748025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]