SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478691524|ref|YP_007748334.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478691524|ref|YP_007748334.1|
Domain Number 1 Region: 92-214
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.54e-24
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.4e-23
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478691524|ref|YP_007748334.1|
Sequence length 227
Comment GntR-family transcriptional regulator [Streptomyces albus J1074]
Sequence
MPLTSPRRSALSEQVIAELRQQITSGEWPVGSRIPTEPELVEQLGVARNTVREAVRALAH
NGLLDIRQGSGTYVVAASELAGVMHRRFADADPRHIAELRATLESTGAELAAVRRTEKDL
KQLDALLGRREDAWESGDAERFVQADATFHLAVVSASHNDVLTALYADLGEVLRHWLRGD
IGDQLQPENHMDHDRLVDAIREGDAERAGAEAATYPLMCRPGRLWQR
Download sequence
Identical sequences A0A0H1AEC6 A0A0X3WRN7 A0A126YEY9 A0A1C4N2N1 A0A1C4SBU8 D6BBL4
gi|478691524|ref|YP_007748334.1| WP_003947374.1.17225 WP_003947374.1.19862 WP_003947374.1.23992 WP_003947374.1.25010 WP_003947374.1.29512 WP_003947374.1.31976 WP_003947374.1.3281 WP_003947374.1.51302 WP_003947374.1.52204 WP_003947374.1.52668 WP_003947374.1.52805 WP_003947374.1.62881 WP_003947374.1.69503 WP_003947374.1.71458 WP_003947374.1.71906 WP_003947374.1.73990 WP_003947374.1.77676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]