SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478691657|ref|YP_007748467.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478691657|ref|YP_007748467.1|
Domain Number 1 Region: 96-226
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.07e-19
Family GntR ligand-binding domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000172
Family GntR-like transcriptional regulators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478691657|ref|YP_007748467.1|
Sequence length 241
Comment Transcriptional regulator [Streptomyces albus J1074]
Sequence
MTTQGGGLHARVLERLGPAITEGQYPAGSVLRTDELAQRYEVSRSVMREAVRVLESMHLV
ASRRRVGVTVLPAEEWNVYDPQVIRWRLAGADRPRQLRSLTVLRSAVEPVAAGLAARHAT
SAQCAELTENALGMVAHSRGHRLEGYLRHDIAFHRVVLRASGNEMFARLGDVVAEVLSGR
THHQVMFHDPDPAAVTLHVRLAEAVRERDAGRAEALTREITIGALQELDILDPPPAAPAG
S
Download sequence
Identical sequences A0A126YA20 A0A1C4MJ44 A0A2A2UB44 D6BAH0
WP_003947238.1.17225 WP_003947238.1.19862 WP_003947238.1.25010 WP_003947238.1.29512 WP_003947238.1.40734 WP_003947238.1.50088 WP_003947238.1.52805 WP_003947238.1.62881 WP_003947238.1.69503 WP_003947238.1.71458 WP_003947238.1.7575 WP_003947238.1.77676 WP_003947238.1.90031 gi|478691657|ref|YP_007748467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]