SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478692373|ref|YP_007749183.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478692373|ref|YP_007749183.1|
Domain Number 1 Region: 41-385
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.77e-68
Family L-arabinose binding protein-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478692373|ref|YP_007749183.1|
Sequence length 399
Comment Extracellular ligand-binding receptor [Streptomyces albus J1074]
Sequence
MFFRASSSRRRARALGAAAVALGLAAVTGCSGGGDAGDGKLKVGLVASLSGTYKPVGTEL
RAGFELYLETHDNKLGGREVELIVADEGDGPPTAVPAATKLVKKDKVDVLTGFVSGGSVN
AVLPLVEQAKIPFLGSNARPPVKDLEYIWTTSFMSDEPGRAIAPYIKEKVDGPVYAIGPD
YQGGYDELRGFTDEFKRVKGKLANPSGKTTWTPFPKTTNFMPYFAEIAKTDAKAVYCFYA
GKAAIDFAKQYAQSDIAHLPLYTAFVTEGSVLQAQGDAAKDIYSVLNYSADLDNDANRKF
VADWTAKHDSQPTTYAMSSYDAAAVLDKAVADAAKDGEVTPQTVNKAIDGLGQIDSPRGA
WEFGAKEHAPVQTWYLRQVRKDGDQLANVMVEDLATLGG
Download sequence
Identical sequences A0A0S1UXG7 A0A0X3XG10 A0A126YCU6 A0A1C4NII2 A0A1C4PKI4 A0A2H9ZPA3 V4IG92
gi|478692373|ref|YP_007749183.1| WP_008405868.1.19862 WP_008405868.1.23992 WP_008405868.1.25010 WP_008405868.1.29512 WP_008405868.1.3281 WP_008405868.1.36028 WP_008405868.1.38292 WP_008405868.1.40734 WP_008405868.1.52204 WP_008405868.1.52668 WP_008405868.1.52805 WP_008405868.1.62881 WP_008405868.1.69503 WP_008405868.1.71906 WP_008405868.1.7575 WP_008405868.1.77676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]